Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42820 246 / 7e-85 HVA22F HVA22-like protein F (.1) AT1G74520 112 / 5e-32 ATHVA22A HVA22 homologue A (.1) AT5G50720 108 / 6e-31 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT5G62490 108 / 2e-30 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT1G69700 107 / 5e-30 ATHVA22C HVA22 homologue C (.1) AT4G24960 102 / 3e-28 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT4G36720 64 / 6e-13 HVA22K HVA22-like protein K (.1) AT1G75700 56 / 3e-10 HVA22G HVA22-like protein G (.1) AT1G19950 55 / 2e-09 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT5G42560 52 / 3e-08 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031386 [exp] 327 / 1e-116 AT2G42820 246 / 4e-85 HVA22-like protein F (.1) Lus10037191 [exp] 123 / 8e-36 AT1G69700 231 / 6e-78 HVA22 homologue C (.1) Lus10023605 [exp] 122 / 3e-35 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10024234 [exp] 122 / 3e-35 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10042193 [exp] 117 / 5e-31 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10043186 [exp] 108 / 9e-31 AT5G50720 169 / 1e-55 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10032557 [exp] 107 / 2e-30 AT5G50720 172 / 8e-57 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10008623 [exp] 104 / 6e-29 AT1G74520 234 / 5e-80 HVA22 homologue A (.1) Lus10034519 [exp] 53 / 1e-08 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G006000 [exp] 224 / 4e-76 AT2G42820 235 / 1e-80 HVA22-like protein F (.1) Potri.012G069300 [exp] 117 / 5e-34 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.015G062800 [exp] 115 / 5e-33 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.014G148600 [exp] 112 / 2e-32 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) Potri.012G101600 [exp] 107 / 3e-30 AT5G50720 133 / 3e-41 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.015G099700 [exp] 106 / 6e-30 AT5G50720 166 / 5e-54 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.005G152100 [exp] 79 / 9e-18 AT1G69700 102 / 1e-25 HVA22 homologue C (.1) Potri.017G139000 [exp] 75 / 3e-16 AT1G74520 119 / 5e-32 HVA22 homologue A (.1) Potri.009G113400 [exp] 70 / 3e-15 AT4G36720 241 / 1e-81 HVA22-like protein K (.1) Potri.009G078500 [exp] 70 / 2e-14 AT1G74520 104 / 6e-26 HVA22 homologue A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [flax] [poplar] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Lus10010944 pacid=23172451 polypeptide=Lus10010944 locus=Lus10010944.g ID=Lus10010944.BGIv1.0 annot-version=v1.0 ATGGGAGTTCCGGTAGCAATAGCCAAAGGTTTGAACGCATTCATCGGGCCGGGGCTGATCCTTCTGTTCCCGTTGTATGCTTCGTTGAGAGCGATCGAGA GCCCTTCGATGGTGGATGACCAGCAATGGCTGACCTACTGGATCATTTACTCCTTCATTACTTTGTTTGAGCTCTCTTTCTGGAAAGTCCTTGCCTGGTT CCCATTCTGGGCGTACATAAAGCTTGTGTTCTGCATGTGGCTTGTGCTCCCGATGTTCAACGGCGCCGCCTATATCCACGAGACCATGTTGAGGAAGTAC GTCAAGATCGGAATCACGACCATCACCGGCGACAACATTTCGAACTACACCGATGAACAGAGGAAGGTGCTTCAGATGATGAGCTTGGACGCTAGGAAGT CTGTGGTTCAGTACGTTAACAAGTACGGCTGGGATGCCGTCGACAGAGCCATCAAAGCTGCTGAAAAGGAGACGAAGAAGCATTAA
AA sequence Show only first row Show all	>Lus10010944 pacid=23172451 polypeptide=Lus10010944 locus=Lus10010944.g ID=Lus10010944.BGIv1.0 annot-version=v1.0 MGVPVAIAKGLNAFIGPGLILLFPLYASLRAIESPSMVDDQQWLTYWIIYSFITLFELSFWKVLAWFPFWAYIKLVFCMWLVLPMFNGAAYIHETMLRKY VKIGITTITGDNISNYTDEQRKVLQMMSLDARKSVVQYVNKYGWDAVDRAIKAAEKETKKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G42820		HVA22F	HVA22-like protein F (.1)		Lus10010944 [exp]	0	1
AT2G42820		HVA22F	HVA22-like protein F (.1)		Lus10031386 [exp]	1.4	0.9814
AT1G13920			Remorin family protein (.1)		Lus10037111 [exp]	1.7	0.9790
AT3G18260			Reticulon family protein (.1)		Lus10032451 [exp]	2.4	0.9803
AT5G03530		ATRABALPHA, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10022608 [exp]	6.2	0.9339
AT5G03530		ATRABALPHA, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10021507 [exp]	6.7	0.9293
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10009316 [exp]	7.5	0.9620
AT5G08391			Protein of unknown function (D...		Lus10035201 [exp]	7.6	0.9029
AT3G05327			Cyclin family protein (.1)		Lus10029933 [exp]	8.7	0.8901
AT1G54400			HSP20-like chaperones superfam...		Lus10032902 [exp]	8.8	0.9560
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	9.2	0.9576

Compare expression of checked genes

Lus10010944 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.