Lus10010981 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G36730 282 / 2e-95 Translation initiation factor IF2/IF5 (.1)
AT1G77840 271 / 3e-91 Translation initiation factor IF2/IF5 (.1)
AT5G20920 54 / 2e-09 EIF2 BETA, EMB1401, EIF2BETA embryo defective 1401, eukaryotic translation initiation factor 2 beta subunit (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002283 298 / 2e-101 AT1G36730 505 / 6e-178 Translation initiation factor IF2/IF5 (.1)
Lus10004057 296 / 9e-101 AT1G36730 505 / 4e-178 Translation initiation factor IF2/IF5 (.1)
Lus10000448 224 / 2e-73 AT1G36730 423 / 7e-147 Translation initiation factor IF2/IF5 (.1)
Lus10007559 52 / 2e-08 AT5G20920 385 / 3e-136 embryo defective 1401, eukaryotic translation initiation factor 2 beta subunit (.1.2.3)
Lus10012186 40 / 0.0002 AT5G20920 373 / 3e-131 embryo defective 1401, eukaryotic translation initiation factor 2 beta subunit (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G093600 295 / 1e-100 AT1G77840 514 / 0.0 Translation initiation factor IF2/IF5 (.1)
Potri.004G112200 291 / 9e-99 AT1G77840 493 / 2e-173 Translation initiation factor IF2/IF5 (.1)
Potri.017G122200 290 / 2e-98 AT1G77840 456 / 1e-158 Translation initiation factor IF2/IF5 (.1)
Potri.013G158400 54 / 3e-09 AT5G20920 396 / 7e-141 embryo defective 1401, eukaryotic translation initiation factor 2 beta subunit (.1.2.3)
Potri.019G131200 54 / 4e-09 AT5G20920 399 / 7e-142 embryo defective 1401, eukaryotic translation initiation factor 2 beta subunit (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Representative CDS sequence
>Lus10010981 pacid=23172493 polypeptide=Lus10010981 locus=Lus10010981.g ID=Lus10010981.BGIv1.0 annot-version=v1.0
ATGGCTTTGCAGAACATTGGTGCTTCAAACAGCGATGATGCCTTCTACAGGTATAAGATGCCCAGAATGGTGACGAAAACCGAGGGCAGAGGAAACGGTA
TCAAGACCAACATTGTCAACATGGTTGACATTGCAAAGGCTTTGGCGAGGCCTGCTTCTTATACTACAAAGTATTTTGGTTGTGAGCTCGGTGCTCAGTC
AAAATTCGACGAGAAGACTGGTATTTTGCTGGTGAATGGTCAGCATGACACTGCAAAGCTTGCGGGGCTTTTGGAGATCTTCATAAAGAAGTATGTTCAG
TGGTATGGCTGTGGGAATCCTGAAACCGAGATACTTATCACCAAAAGCCAGATGCTCCAGCTTAAATGTGCTGCCTGTGGTTTTGTCTCTGATGTGGATA
TGAGAGATAAGCTGACTACTTTTATCTTGAAGAATCCGCCCTAA
AA sequence
>Lus10010981 pacid=23172493 polypeptide=Lus10010981 locus=Lus10010981.g ID=Lus10010981.BGIv1.0 annot-version=v1.0
MALQNIGASNSDDAFYRYKMPRMVTKTEGRGNGIKTNIVNMVDIAKALARPASYTTKYFGCELGAQSKFDEKTGILLVNGQHDTAKLAGLLEIFIKKYVQ
WYGCGNPETEILITKSQMLQLKCAACGFVSDVDMRDKLTTFILKNPP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G36730 Translation initiation factor ... Lus10010981 0 1
AT5G22130 PNT1 PEANUT 1, mannosyltransferase ... Lus10013349 1.0 0.8896
AT1G60940 SNRK2-10, SNRK2... SNF1-RELATED KINASE 2B, SUCROS... Lus10001367 11.2 0.8573
AT5G10290 leucine-rich repeat transmembr... Lus10000629 12.7 0.8361
AT4G16800 ATP-dependent caseinolytic (Cl... Lus10010994 19.2 0.8305
AT1G25500 Plasma-membrane choline transp... Lus10041476 19.6 0.8104
AT4G14340 CKL11, CKI1 CASEIN KINASE I-LIKE 11, casei... Lus10021175 27.1 0.8361
AT5G47540 Mo25 family protein (.1) Lus10017565 29.1 0.8079
AT1G79830 GC5 golgin candidate 5 (.1.2.3.4) Lus10011437 31.9 0.7899
AT1G55730 ATCAX5 cation exchanger 5 (.1.2) Lus10034853 45.8 0.8037
AT5G04870 AK1, ATCPK1, CP... calcium dependent protein kina... Lus10028862 52.0 0.7545

Lus10010981 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.