Lus10010985 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05620 98 / 3e-26 TUBG2 ,ATGCP2 GAMMA-TUBULIN 2, ARABIDOPSIS THALIANA GAMMA-TUBULIN COMPLEX PROTEIN 2, gamma-tubulin complex protein 2 (.1)
AT3G61650 98 / 4e-26 TUBG1 gamma-tubulin (.1)
AT5G23860 52 / 1e-09 TUB8, b-TUB tubulin beta 8 (.1.2)
AT5G62700 52 / 2e-09 atgcp3, TUB3 tubulin beta chain 3 (.1)
AT5G62690 52 / 2e-09 TUB2 tubulin beta chain 2 (.1)
AT4G20890 51 / 2e-09 TUB9 tubulin beta-9 chain (.1)
AT5G44340 51 / 2e-09 TUB4 tubulin beta chain 4 (.1)
AT1G20010 51 / 2e-09 TUB5 tubulin beta-5 chain (.1)
AT5G12250 50 / 4e-09 TUB6 beta-6 tubulin (.1)
AT2G29550 50 / 6e-09 TUB7 tubulin beta-7 chain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007851 93 / 4e-24 AT3G61650 938 / 0.0 gamma-tubulin (.1)
Lus10039231 53 / 5e-10 AT5G23860 912 / 0.0 tubulin beta 8 (.1.2)
Lus10027476 53 / 5e-10 AT5G23860 912 / 0.0 tubulin beta 8 (.1.2)
Lus10040712 52 / 1e-09 AT5G23860 923 / 0.0 tubulin beta 8 (.1.2)
Lus10016448 52 / 1e-09 AT5G23860 921 / 0.0 tubulin beta 8 (.1.2)
Lus10002000 51 / 2e-09 AT5G62690 824 / 0.0 tubulin beta chain 2 (.1)
Lus10035497 51 / 2e-09 AT5G62690 824 / 0.0 tubulin beta chain 2 (.1)
Lus10008528 51 / 3e-09 AT5G12250 837 / 0.0 beta-6 tubulin (.1)
Lus10038458 51 / 3e-09 AT2G29550 850 / 0.0 tubulin beta-7 chain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G167800 99 / 3e-26 AT5G05620 958 / 0.0 GAMMA-TUBULIN 2, ARABIDOPSIS THALIANA GAMMA-TUBULIN COMPLEX PROTEIN 2, gamma-tubulin complex protein 2 (.1)
Potri.014G094900 97 / 7e-26 AT3G61650 960 / 0.0 gamma-tubulin (.1)
Potri.001G106100 55 / 8e-11 AT5G23860 858 / 0.0 tubulin beta 8 (.1.2)
Potri.003G125400 53 / 3e-10 AT5G23860 857 / 0.0 tubulin beta 8 (.1.2)
Potri.002G021800 53 / 5e-10 AT1G20010 838 / 0.0 tubulin beta-5 chain (.1)
Potri.009G040200 52 / 7e-10 AT5G23860 864 / 0.0 tubulin beta 8 (.1.2)
Potri.006G095000 52 / 9e-10 AT5G23860 852 / 0.0 tubulin beta 8 (.1.2)
Potri.011G162500 52 / 9e-10 AT5G23860 847 / 0.0 tubulin beta 8 (.1.2)
Potri.001G246900 52 / 1e-09 AT5G62700 858 / 0.0 tubulin beta chain 3 (.1)
Potri.001G464400 52 / 1e-09 AT5G62700 850 / 0.0 tubulin beta chain 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0566 Tubulin PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Representative CDS sequence
>Lus10010985 pacid=23148676 polypeptide=Lus10010985 locus=Lus10010985.g ID=Lus10010985.BGIv1.0 annot-version=v1.0
ATGCCGAGAGAAATCATCACTCTTCAAGTTGGGCAATGCGGGAACCAGATTGGCATGGAGTTCTGGAAGCAGCTATGCCTCGAACATGGCATCAGCAAAG
ACGGCATTCTCGAGGATTTCGCTACCCAGATTGCGAAGTTAGCTGTAGTTGGAAATGTGATCTTACTTACACTGTGA
AA sequence
>Lus10010985 pacid=23148676 polypeptide=Lus10010985 locus=Lus10010985.g ID=Lus10010985.BGIv1.0 annot-version=v1.0
MPREIITLQVGQCGNQIGMEFWKQLCLEHGISKDGILEDFATQIAKLAVVGNVILLTL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61650 TUBG1 gamma-tubulin (.1) Lus10010985 0 1
AT5G42630 GARP KAN4, KANADI4, ... KANADI 4, ABERRANT TESTA SHAPE... Lus10011660 1.7 0.8314
AT3G26120 TEL1 terminal EAR1-like 1 (.1) Lus10006234 5.5 0.8017
AT1G25580 NAC ANAC008, SOG1 SUPPRESSOR OF GAMMA RADIATION ... Lus10021708 7.5 0.7869
AT2G15730 P-loop containing nucleoside t... Lus10042667 8.5 0.7496
AT4G37810 unknown protein Lus10011570 14.7 0.7560
Lus10037800 16.1 0.6912
AT2G33320 Calcium-dependent lipid-bindin... Lus10003570 21.8 0.6546
AT1G08370 DCP1, ATDCP1 decapping 1 (.1) Lus10017007 22.4 0.6770
AT1G80100 AHP6 histidine phosphotransfer prot... Lus10011487 23.4 0.7270
AT1G18090 5'-3' exonuclease family prote... Lus10038958 23.9 0.7307

Lus10010985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.