Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 122 / 9e-32 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72950 111 / 6e-29 Disease resistance protein (TIR-NBS class) (.1) AT1G72900 111 / 7e-29 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72920 108 / 9e-29 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72930 103 / 8e-28 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72940 107 / 2e-27 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72910 106 / 5e-27 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G17615 105 / 1e-26 Disease resistance protein (TIR-NBS class) (.1) AT4G09430 101 / 1e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72890 100 / 1e-24 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007852 [exp] 412 / 9e-149 AT5G36930 124 / 1e-32 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007811 [exp] 203 / 4e-60 AT5G36930 376 / 1e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004727 [exp] 193 / 4e-60 AT1G27180 182 / 2e-53 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10000331 [exp] 200 / 6e-59 AT5G36930 217 / 1e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007808 [exp] 200 / 7e-59 AT5G36930 418 / 1e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008519 [exp] 193 / 2e-56 AT1G27180 344 / 2e-98 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10008526 [exp] 192 / 4e-56 AT5G36930 361 / 5e-106 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007812 [exp] 188 / 7e-55 AT5G36930 359 / 4e-106 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10002249 [exp] 187 / 1e-54 AT5G36930 286 / 2e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T002428 [exp] 139 / 2e-38 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 139 / 2e-38 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 139 / 6e-38 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 138 / 1e-37 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 137 / 3e-37 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001314 [exp] 130 / 3e-37 AT5G36930 183 / 1e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 137 / 4e-37 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002300 [exp] 136 / 1e-36 AT5G36930 635 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 134 / 1e-36 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019053 [exp] 135 / 2e-36 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10010987 pacid=23148640 polypeptide=Lus10010987 locus=Lus10010987.g ID=Lus10010987.BGIv1.0 annot-version=v1.0 ATGGATTACTACATGAGAGTAGGCGTGACAGTTGCCGCCACATTGCTTCCAGTGCTCATAACAATGTTCTACAAGTGGTTCTCCGGAAAGAGGAATCTGA AATCCGCCTCGAATTCACCGGCCCTCCCTTCTACAGACTACAAGGTGTTTTTGAGCTTCAGAGGTCCAGACGCTGGTCAGTTCGTCGACATTCTTTATCG TATCCTAGTTCAGGCAAATATCCGCACGTTCAAAGACGACAAGGAACTTCCCAAAGGGGAGGGACTGTCTACCGAGACCGTCAAGGCAATCGACCAGTGC AAAATATTCGTGGTGGTCGTGTCGAAGAACTACGCTAATGACACAAGGTGCCTCAGGGAGCTCGTCGAGATCTCAGAACGCCACAAGCAGGATAACCGGC GTGTCATACTTCCAATTTTTTATATGATGGATCCAAAGAGCGTGAAATTCCTTATCGGACCTTATCGGAACTCGTTTACAGTGCACCACAGGAACTTCCC TGAAGCTACTGTACAGAGCTGGAAAATTGCTTTGAGTGACCTCGGATCGCTAAAGGGCTGGCCAGTAAACAGCGAGAACGAGCATGGTGCTGTAGCAGAC AAAGTTTCTGGGGCTATACGGTCACAGCTGAGCAAGAGCAGTGATAATGGTGGAGACTGA
AA sequence Show only first row Show all	>Lus10010987 pacid=23148640 polypeptide=Lus10010987 locus=Lus10010987.g ID=Lus10010987.BGIv1.0 annot-version=v1.0 MDYYMRVGVTVAATLLPVLITMFYKWFSGKRNLKSASNSPALPSTDYKVFLSFRGPDAGQFVDILYRILVQANIRTFKDDKELPKGEGLSTETVKAIDQC KIFVVVVSKNYANDTRCLRELVEISERHKQDNRRVILPIFYMMDPKSVKFLIGPYRNSFTVHHRNFPEATVQSWKIALSDLGSLKGWPVNSENEHGAVAD KVSGAIRSQLSKSSDNGGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10010987 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10007852 [exp]	1.0	0.9948
AT5G36930			Disease resistance protein (TI...		Lus10004726 [exp]	1.4	0.9881
AT1G27180			disease resistance protein (TI...		Lus10007831 [exp]	3.2	0.9716
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	3.5	0.9807
AT1G79910			Regulator of Vps4 activity in ...		Lus10025779 [exp]	3.5	0.9759
AT5G18970			AWPM-19-like family protein (....		Lus10041238 [exp]	4.9	0.9684
AT4G15210		BAM5, AT-BETA-A...	REDUCED BETA AMYLASE 1, ARABID...		Lus10039702 [exp]	5.5	0.9555
AT3G18670			Ankyrin repeat family protein ...		Lus10035567 [exp]	5.7	0.9537
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006306 [exp]	6.0	0.9513
AT3G27030			unknown protein		Lus10035199 [exp]	6.1	0.9282

Compare expression of checked genes

Lus10010987 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.