Lus10010993 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08180 229 / 2e-78 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
AT4G12600 59 / 1e-11 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
AT5G20160 57 / 3e-11 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
AT4G22380 57 / 3e-11 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
AT2G47610 45 / 3e-06 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
AT3G62870 42 / 7e-05 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000421 300 / 1e-106 AT5G08180 240 / 9e-83 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10040161 261 / 6e-91 AT5G08180 226 / 4e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10004366 259 / 4e-90 AT5G08180 227 / 1e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10017031 61 / 2e-12 AT4G22380 220 / 2e-75 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10019420 62 / 7e-12 AT5G55190 443 / 8e-159 RAN GTPase 3 (.1)
Lus10043276 62 / 8e-12 AT5G55190 428 / 9e-153 RAN GTPase 3 (.1)
Lus10015295 57 / 4e-10 AT4G22380 217 / 7e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10025435 56 / 1e-09 AT4G22380 203 / 7e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10010763 42 / 4e-05 AT3G62870 441 / 3e-159 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G110100 241 / 4e-83 AT5G08180 225 / 8e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.013G116800 60 / 3e-12 AT4G12600 216 / 3e-74 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.019G087100 57 / 5e-11 AT4G12600 213 / 9e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.004G113800 42 / 3e-05 AT3G62870 399 / 5e-142 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.017G100800 42 / 4e-05 AT3G62870 377 / 1e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.017G101000 42 / 4e-05 AT3G62870 376 / 3e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.004G113900 41 / 0.0001 AT3G62870 362 / 7e-127 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.001G326400 40 / 0.0003 AT2G47610 385 / 1e-136 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0101 PELOTA PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence
>Lus10010993 pacid=23148669 polypeptide=Lus10010993 locus=Lus10010993.g ID=Lus10010993.BGIv1.0 annot-version=v1.0
ATGGAGAAGTCGCAGAAGAAAGAAAAGAAGACGACTCCGGTAACTCTAGCTCCCATCGCCAAGCCCCTCGCTGGGAAGAAGCTCTGCAAGCGGACTTTCA
AGCTCGTCCGTAGAGCTGCTGATAATAAGTGCTTGAAAAGAGGAGTGAAGGAGGTTGTCAAGAGCATTCGACGTGGGAATAAAGGGATATGCATCATTGC
CGGGAACATATCTCCGATCGATGTCATAACTCACGTCCCAATACTGTGTGAAGAGGCTGAAGTTCCATACTTCTATGTTCCTTCAAAAGAAGATCTTGCA
ACTGCAGGAAACACGAAGAGGCCTACGTGCTGCGTGTTGGTTCAGATGAAGCCTGCCAAGGGAGAGTTGGCTAAAGAAGAACAAGAGAAGTTGAAGTCTG
ATTATGATCAAGTTGTAGCTGATGTATCTGAACTCAGTTCCTCTCTTTTCTGA
AA sequence
>Lus10010993 pacid=23148669 polypeptide=Lus10010993 locus=Lus10010993.g ID=Lus10010993.BGIv1.0 annot-version=v1.0
MEKSQKKEKKTTPVTLAPIAKPLAGKKLCKRTFKLVRRAADNKCLKRGVKEVVKSIRRGNKGICIIAGNISPIDVITHVPILCEEAEVPYFYVPSKEDLA
TAGNTKRPTCCVLVQMKPAKGELAKEEQEKLKSDYDQVVADVSELSSSLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10010993 0 1
AT3G52570 alpha/beta-Hydrolases superfam... Lus10016992 3.2 0.8793
AT2G19730 Ribosomal L28e protein family ... Lus10037609 6.2 0.8485
AT3G52570 alpha/beta-Hydrolases superfam... Lus10021315 6.9 0.8513
AT4G18100 Ribosomal protein L32e (.1) Lus10012195 7.1 0.8345
AT4G39200 Ribosomal protein S25 family p... Lus10035060 7.2 0.8469
AT2G19730 Ribosomal L28e protein family ... Lus10006869 9.2 0.8296
AT5G04600 RNA-binding (RRM/RBD/RNP motif... Lus10018666 11.0 0.8173
AT2G30260 U2B'' U2 small nuclear ribonucleopro... Lus10026413 11.4 0.8133
AT5G56940 Ribosomal protein S16 family p... Lus10025984 13.0 0.8192
AT3G29310 calmodulin-binding protein-rel... Lus10026469 14.0 0.7599

Lus10010993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.