Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17040 183 / 4e-57 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G12410 95 / 3e-23 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT5G23140 88 / 8e-21 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT5G45390 86 / 9e-20 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G02560 86 / 1e-19 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT1G11750 81 / 6e-18 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT1G09130 77 / 2e-16 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT1G49970 76 / 5e-16 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) AT1G66670 74 / 2e-15 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012156 [exp] 97 / 5e-24 AT5G45390 293 / 1e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Lus10007589 [exp] 96 / 1e-23 AT5G45390 293 / 2e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Lus10040982 [exp] 96 / 3e-23 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 93 / 1e-22 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10017397 [exp] 93 / 1e-22 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10013435 [exp] 93 / 5e-22 AT5G23140 209 / 5e-66 nuclear-encoded CLP protease P7 (.1) Lus10013434 [exp] 91 / 2e-21 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 88 / 2e-20 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10010003 [exp] 82 / 2e-18 AT1G02560 308 / 2e-105 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G083300 [exp] 195 / 1e-61 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1) Potri.007G071700 [exp] 94 / 1e-22 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.005G092600 [exp] 93 / 1e-22 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.009G114001 [exp] 91 / 7e-22 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.004G152900 [exp] 91 / 1e-21 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.003G103300 [exp] 88 / 1e-20 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.001G115900 [exp] 87 / 2e-20 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.001G295266 [exp] 82 / 3e-19 AT1G49970 306 / 5e-105 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Potri.002G195200 [exp] 84 / 6e-19 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.009G089300 [exp] 85 / 7e-19 AT1G49970 459 / 7e-162 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [flax] [poplar] ClpP_crotonase PF00574 [flax] [poplar] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Lus10011014 pacid=23148651 polypeptide=Lus10011014 locus=Lus10011014.g ID=Lus10011014.BGIv1.0 annot-version=v1.0 ATGGAGCTCGCAGCAGCTGCAGCTTCATCAACCGTCGCGATATCGAGGCTCACTACGTCGTCCTTTCCGGCGACGAATTTCAACTTGTCATCATTATCAC AGCGCAACAGACCTCTCTCCTTACGTTCCTCCTCCTCCGGCGCCGTCGGAGAATCGTTCGGAATTATCAAGAGCAATCCAGACTCCATCCACTTTCCTGC TTCGGTAGCGAGTCCTAGGCCGAGAAGGAGCCTCGTCGCCAGGGCAACGGACCAAAGGAAGCCGAGTTATGAACAAGAGGCCTTGACTGTTCATGATATG ATGATGTATTCAAAGGCACCAATATTTACCCTATGTGTCGGTAACGCTTGGGGAGAAGCAGCGTTGCTCTTGGCTAGTGGTTCTAAGGGAAACCGTGCTG CATTGCCTTCAGCAAGTATCATGATAAAGGAGGCTGTCGGGGGATTTCAAGGCCATACTACAGATGTTGAGCGTGCCAGACAGCGACTGAAAGCTGTTAG AGGAGATATTGTCAACCTTTTGGCATCACATACTAGACAGACTCGCGAGCGGATCGAAGCTGATTACACCCGGCCAAAGTATTTCAGTCCATCCGAGGCC ATCGAATATGGACTCATCGACAAAATCTTGTACTCCGACAGAGACGCTGAAGCTCAGAATGGAAATCGCGGAGTTGTCAACAATCTTAAGGATGCAAATC TGATATAA
AA sequence Show only first row Show all	>Lus10011014 pacid=23148651 polypeptide=Lus10011014 locus=Lus10011014.g ID=Lus10011014.BGIv1.0 annot-version=v1.0 MELAAAAASSTVAISRLTTSSFPATNFNLSSLSQRNRPLSLRSSSSGAVGESFGIIKSNPDSIHFPASVASPRPRRSLVARATDQRKPSYEQEALTVHDM MMYSKAPIFTLCVGNAWGEAALLLASGSKGNRAALPSASIMIKEAVGGFQGHTTDVERARQRLKAVRGDIVNLLASHTRQTRERIEADYTRPKYFSPSEA IEYGLIDKILYSDRDAEAQNGNRGVVNNLKDANLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17040		HON5, CLPR4	happy on norflurazon 5, CLP pr...		Lus10011014 [exp]	0	1
AT1G14410		WHY1, ATWHY1, P...	A. THALIANA WHIRLY 1, ssDNA-bi...		Lus10037206 [exp]	2.0	0.9213
AT3G54090		FLN1	fructokinase-like 1 (.1)		Lus10017191 [exp]	4.0	0.9285
AT4G27990		ATYLMG1-2	YGGT family protein (.1)		Lus10020405 [exp]	5.3	0.9151
AT4G38020			tRNA/rRNA methyltransferase (S...		Lus10035953 [exp]	7.1	0.9147
AT4G12060			Double Clp-N motif protein (.1...		Lus10031694 [exp]	7.7	0.8893
AT1G72040			P-loop containing nucleoside t...		Lus10016950 [exp]	8.0	0.8873
AT5G53860		EMB64, EMB2737	EMBRYO DEFECTIVE 64, embryo de...		Lus10009197 [exp]	8.1	0.9195
AT5G43960			Nuclear transport factor 2 (NT...		Lus10014469 [exp]	11.2	0.8867
AT3G20230			Ribosomal L18p/L5e family prot...		Lus10007379 [exp]	12.5	0.9006
AT3G20230			Ribosomal L18p/L5e family prot...		Lus10020797 [exp]	12.8	0.9011

Compare expression of checked genes

Lus10011014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.