Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08305 77 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G13600 77 / 2e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G37170 75 / 8e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G62890 74 / 2e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G06540 74 / 3e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18840 74 / 3e-16 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G04750 73 / 4e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G21090 70 / 5e-15 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G14470 69 / 7e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G42920 69 / 7e-15 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004303 [exp] 197 / 3e-65 AT2G21090 146 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10003383 [exp] 189 / 4e-62 AT2G21090 145 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10019213 [exp] 188 / 4e-58 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10030125 [exp] 81 / 7e-19 AT2G20540 618 / 0.0 mitochondrial editing factor 21 (.1) Lus10038431 [exp] 80 / 2e-18 AT4G20770 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10016425 [exp] 77 / 1e-17 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10010183 [exp] 75 / 1e-16 AT5G08305 529 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017386 [exp] 73 / 3e-16 AT5G08305 357 / 9e-120 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022629 [exp] 73 / 4e-16 AT2G41080 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G091600 [exp] 81 / 5e-19 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G035900 [exp] 80 / 2e-18 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G073100 [exp] 78 / 6e-18 AT5G08305 600 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G207500 [exp] 77 / 1e-17 AT5G37570 602 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.002G075300 [exp] 73 / 4e-16 AT3G26540 815 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G086100 [exp] 73 / 4e-16 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G185300 [exp] 72 / 8e-16 AT1G43980 635 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G035900 [exp] 71 / 3e-15 AT2G20540 709 / 0.0 mitochondrial editing factor 21 (.1) Potri.002G087400 [exp] 70 / 5e-15 AT4G08210 889 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.002G075200 [exp] 69 / 2e-14 AT1G77010 835 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10011025 pacid=23148652 polypeptide=Lus10011025 locus=Lus10011025.g ID=Lus10011025.BGIv1.0 annot-version=v1.0 ATGGTTTCAATCGATCCCGCCTCAGCAATCAACGAATACGGGTGCATCACCTCTAGGAACCTCAAACTCGTCAAAACCGCGATCAACTTTAACTCCTTCG TCGTCAACCGTCTCATCTACATGTACTCCAAATGCAGCTCCATAGGCAGCGCCCATAAGGCCTTCGACGATCTCCCCTTCAAGAACGCTCGTTCCTGGAA CACCATCGTCTCCGCCTGCTCCAAATTGGGTATGGTGAAAACGGCGCGCAAACTGTTGGATGAAATGCCTGAACGCAATCTCGCCAGCTACAACTCGATG ATTTCAGGGCTTTCTCGTGGTGGGTATATTCAGAGAGATGAATCGGTTAGTGCCGAATGA
AA sequence Show only first row Show all	>Lus10011025 pacid=23148652 polypeptide=Lus10011025 locus=Lus10011025.g ID=Lus10011025.BGIv1.0 annot-version=v1.0 MVSIDPASAINEYGCITSRNLKLVKTAINFNSFVVNRLIYMYSKCSSIGSAHKAFDDLPFKNARSWNTIVSACSKLGMVKTARKLLDEMPERNLASYNSM ISGLSRGGYIQRDESVSAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10011025 [exp]	0	1
AT5G41150		ATRAD1, UVH1	ULTRAVIOLET HYPERSENSITIVE 1, ...		Lus10011024 [exp]	3.5	0.7505
AT3G05030		ATNHX2, NHX2	sodium hydrogen exchanger 2 (....		Lus10040903 [exp]	10.4	0.7508
AT4G18020	GARP	APRR2	PSEUDO-RESPONSE REGULATOR 2, C...		Lus10011044 [exp]	10.8	0.7332
AT5G03330			Cysteine proteinases superfami...		Lus10023019 [exp]	12.3	0.7224
AT5G24810			ABC1 family protein (.1.2)		Lus10026971 [exp]	23.7	0.7092
AT5G37020	ARF	ARF8, ATARF8	auxin response factor 8 (.1.2)		Lus10017640 [exp]	26.5	0.7266
AT2G45900			Phosphatidylinositol N-acetygl...		Lus10042850 [exp]	28.4	0.7334
AT3G54810	GATA	GATA8, BME3, BM...	GATA TRANSCRIPTION FACTOR 8, B...		Lus10037994 [exp]	28.5	0.7277
AT5G51640		TBL17, YLS7	YELLOW-LEAF-SPECIFIC GENE 7, T...		Lus10031117 [exp]	28.7	0.7246
AT4G18020	GARP	APRR2	PSEUDO-RESPONSE REGULATOR 2, C...		Lus10003013 [exp]	39.3	0.6348

Compare expression of checked genes

Lus10011025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.