Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14040 72 / 1e-16 Pectin lyase-like superfamily protein (.1) AT3G07850 71 / 2e-16 Pectin lyase-like superfamily protein (.1) AT3G07840 67 / 4e-15 Pectin lyase-like superfamily protein (.1) AT3G07820 66 / 2e-14 Pectin lyase-like superfamily protein (.1) AT5G48140 65 / 3e-14 Pectin lyase-like superfamily protein (.1) AT3G07830 64 / 7e-14 Pectin lyase-like superfamily protein (.1) AT4G18180 57 / 2e-11 Pectin lyase-like superfamily protein (.1) AT2G43890 56 / 4e-11 Pectin lyase-like superfamily protein (.1) AT2G33160 56 / 7e-11 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein (.1) AT3G59850 52 / 8e-10 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003001 [exp] 107 / 3e-29 AT3G07840 362 / 1e-118 Pectin lyase-like superfamily protein (.1) Lus10043088 [exp] 76 / 4e-18 AT3G07820 360 / 6e-123 Pectin lyase-like superfamily protein (.1) Lus10006171 [exp] 74 / 4e-17 AT1G71140 452 / 5e-154 MATE efflux family protein (.1) Lus10043087 [exp] 71 / 2e-16 AT3G07840 268 / 4e-89 Pectin lyase-like superfamily protein (.1) Lus10009606 [exp] 71 / 4e-16 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1) Lus10009605 [exp] 70 / 6e-16 AT3G07840 317 / 1e-102 Pectin lyase-like superfamily protein (.1) Lus10039154 [exp] 69 / 2e-15 AT5G48140 335 / 8e-113 Pectin lyase-like superfamily protein (.1) Lus10013784 [exp] 64 / 8e-14 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1) Lus10013780 [exp] 64 / 8e-14 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G066800 [exp] 78 / 9e-19 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067000 [exp] 78 / 9e-19 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067050 [exp] 78 / 9e-19 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067166 [exp] 75 / 1e-17 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067200 [exp] 75 / 1e-17 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067133 [exp] 75 / 1e-17 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067100 [exp] 74 / 1e-17 AT3G07820 404 / 5e-140 Pectin lyase-like superfamily protein (.1) Potri.014G162300 [exp] 64 / 6e-14 AT3G07850 358 / 3e-122 Pectin lyase-like superfamily protein (.1) Potri.007G035800 [exp] 64 / 8e-14 AT3G07820 350 / 7e-119 Pectin lyase-like superfamily protein (.1) Potri.007G144500 [exp] 59 / 4e-12 AT3G59850 493 / 3e-175 Pectin lyase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF00295 [flax] [poplar] Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence Show only first row Show all	>Lus10011030 pacid=23148699 polypeptide=Lus10011030 locus=Lus10011030.g ID=Lus10011030.BGIv1.0 annot-version=v1.0 ATGGGCAGATCTATTGGAGTCAACATCGTAGATTCCATCTTCGAAACGGGTGATGACTGCATATCCGTAGGAGACTGCATTGAGCAACTGAGGATCGAGA ACGTCAAGTGTGGACCTGGACATGGAATTATCATTGTCAGCCTTGGTGGGAGCCCTGGGGAGAAGTCTGTTGTAGGAGTGTTTCGTCAAGAACTGTAG
AA sequence Show only first row Show all	>Lus10011030 pacid=23148699 polypeptide=Lus10011030 locus=Lus10011030.g ID=Lus10011030.BGIv1.0 annot-version=v1.0 MGRSIGVNIVDSIFETGDDCISVGDCIEQLRIENVKCGPGHGIIIVSLGGSPGEKSVVGVFRQEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07840			Pectin lyase-like superfamily ...		Lus10011030 [exp]	0	1
					Lus10012132 [exp]	1.0	0.9552
					Lus10010271 [exp]	2.0	0.9488
					Lus10025017 [exp]	2.0	0.8846
AT2G37890			Mitochondrial substrate carrie...		Lus10036193 [exp]	3.5	0.8686
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10027514 [exp]	4.5	0.8698
AT3G07960		PIP5K6	phosphatidylinositol-4-phospha...		Lus10039507 [exp]	6.0	0.8577
					Lus10000890 [exp]	6.2	0.8480
AT5G01250			alpha 1,4-glycosyltransferase ...		Lus10035526 [exp]	8.7	0.8323
AT5G53970		TAT7	tyrosine aminotransferase 7, T...		Lus10032654 [exp]	10.7	0.9078
AT5G24600			Protein of unknown function, D...		Lus10005272 [exp]	14.4	0.8395

Compare expression of checked genes

Lus10011030 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.