Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40080 146 / 2e-47 Mitochondrial ribosomal protein L27 (.1) AT4G09012 137 / 4e-43 Mitochondrial ribosomal protein L27 (.1) AT5G39800 130 / 3e-41 Mitochondrial ribosomal protein L27 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003002 [exp] 186 / 4e-63 AT5G40080 147 / 4e-48 Mitochondrial ribosomal protein L27 (.1) Lus10034241 [exp] 172 / 9e-58 AT5G40080 137 / 5e-44 Mitochondrial ribosomal protein L27 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G161600 [exp] 169 / 2e-56 AT5G40080 144 / 8e-47 Mitochondrial ribosomal protein L27 (.1) Potri.006G070700 [exp] 168 / 3e-56 AT5G40080 150 / 4e-49 Mitochondrial ribosomal protein L27 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09809 [flax] [poplar] MRP-L27 Mitochondrial ribosomal protein L27
Representative CDS sequence Show only first row Show all	>Lus10011032 pacid=23148641 polypeptide=Lus10011032 locus=Lus10011032.g ID=Lus10011032.BGIv1.0 annot-version=v1.0 ATGCCGCTGGGTTTGATAGCTGGGATAGCTAGGGCGATGAGGAGGAAGAGGACTTCGTCGCTGGACATTCTCTCGTCCAAACGAGCTCCTCGTAATTTCT ACAAGGGAAAGAACTGCAAACCCACTGGTTTCCATACTCGCAAAGGTGGTTACGTCATCGTGCCGGAGAAGTTGCCCAACTACGTAGTTCCCGATTTGAC CAACTTCATGCTCAAACCATATGTATCGCAGTGCCCAGTTGAAGCTCAGACAACTGAAGCGTCTGTAGCAGCCTAA
AA sequence Show only first row Show all	>Lus10011032 pacid=23148641 polypeptide=Lus10011032 locus=Lus10011032.g ID=Lus10011032.BGIv1.0 annot-version=v1.0 MPLGLIAGIARAMRRKRTSSLDILSSKRAPRNFYKGKNCKPTGFHTRKGGYVIVPEKLPNYVVPDLTNFMLKPYVSQCPVEAQTTEASVAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40080			Mitochondrial ribosomal protei...		Lus10011032 [exp]	0	1
AT5G18790			Ribosomal protein L33 family p...		Lus10012786 [exp]	1.4	0.9137
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10014035 [exp]	6.4	0.9218
AT3G18760			Translation elongation factor...		Lus10006729 [exp]	7.9	0.8875
AT3G06700			Ribosomal L29e protein family ...		Lus10016875 [exp]	15.1	0.9109
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10034179 [exp]	15.3	0.8922
AT1G76010			Alba DNA/RNA-binding protein (...		Lus10005615 [exp]	16.1	0.8899
AT1G07070			Ribosomal protein L35Ae family...		Lus10021121 [exp]	17.2	0.8570
AT5G40080			Mitochondrial ribosomal protei...		Lus10003002 [exp]	17.9	0.8929
AT3G06700			Ribosomal L29e protein family ...		Lus10037740 [exp]	18.5	0.9097
AT2G47640			Small nuclear ribonucleoprotei...		Lus10030367 [exp]	18.5	0.8625

Compare expression of checked genes

Lus10011032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.