Lus10011040 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21940 38 / 0.001 Receptor protein kinase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042124 65 / 3e-13 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1)
Lus10028981 59 / 7e-12 ND 35 / 0.007
Lus10002371 55 / 2e-10 AT4G38830 37 / 0.001 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
Lus10007505 53 / 3e-09 ND 39 / 0.002
Lus10007506 50 / 3e-08 AT3G22040 39 / 5e-04 Domain of unknown function (DUF26) (.1)
Lus10007508 43 / 2e-06 ND /
Lus10007507 41 / 3e-05 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10011040 pacid=23148626 polypeptide=Lus10011040 locus=Lus10011040.g ID=Lus10011040.BGIv1.0 annot-version=v1.0
ATGTCGGTTACGTTGATGGTGATGCTCGTTGGATTGACGGCATTAAATGGTCACGAAGCAGACGGTGATTACAAATTCAACATTCGTTGGAATTCTACGA
AGTTCGACGCAAACAAAGACCAAGGTCTGAGGGATAGCGAAGATGAGATCAAGAAGTACCTCCGTTACGGGTATTTCGCCCAGATAGCTCTAAACGACCT
TATGACTCCGTTTCATCAAATGTACGTTAAGCCCCATTGTAGCATGACCGCCGTCAATGAGTGTCGTGCGTGTCACGAGAAGGTTGCATCGACGTTGGAC
GATTGTTGCGTAAACTTCTACGGTGTTGATGTTCAAGGTGATGTCTGTGGGTTTCGATACGAGACTTACCGATTTTGA
AA sequence
>Lus10011040 pacid=23148626 polypeptide=Lus10011040 locus=Lus10011040.g ID=Lus10011040.BGIv1.0 annot-version=v1.0
MSVTLMVMLVGLTALNGHEADGDYKFNIRWNSTKFDANKDQGLRDSEDEIKKYLRYGYFAQIALNDLMTPFHQMYVKPHCSMTAVNECRACHEKVASTLD
DCCVNFYGVDVQGDVCGFRYETYRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G21940 Receptor protein kinase-relate... Lus10011040 0 1

Lus10011040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.