Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003016 [exp] 149 / 3e-45 AT1G13570 81 / 1e-16 F-box/RNI-like superfamily protein (.1) Lus10011048 [exp] 144 / 1e-42 AT1G13570 127 / 2e-32 F-box/RNI-like superfamily protein (.1) Lus10020638 [exp] 74 / 2e-18 AT1G13570 37 / 0.002 F-box/RNI-like superfamily protein (.1) Lus10026712 [exp] 69 / 3e-15 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2) Lus10004851 [exp] 68 / 1e-14 AT1G13570 139 / 7e-37 F-box/RNI-like superfamily protein (.1) Lus10004852 [exp] 68 / 1e-14 AT1G13570 147 / 6e-39 F-box/RNI-like superfamily protein (.1) Lus10004849 [exp] 58 / 4e-11 ND 41 / 6e-04 Lus10015828 [exp] 50 / 8e-09 ND / Lus10004853 [exp] 49 / 4e-08 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G134200 [exp] 47 / 2e-07 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1) Potri.008G110400 [exp] 40 / 9e-05 AT1G13570 419 / 2e-144 F-box/RNI-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08387 [flax] [poplar] FBD FBD
Representative CDS sequence Show only first row Show all	>Lus10011047 pacid=23148649 polypeptide=Lus10011047 locus=Lus10011047.g ID=Lus10011047.BGIv1.0 annot-version=v1.0 ATGGCAAAGGCTATGGTCAGCTCTATAGATGTTGGAACACTCCAAAGCTGGGTGGAAGATGAAGACGGTGTTTCTCTGTATGTGCTTAGACGACTCAAGA CAGTGGAAGTGAAGAATCTGAAAGGTACAAGGCATGAAATAACTTGGATTCAATGGTTATTGAAGTCCTCACCAGTACTGGACGAGATGGAGATCACACT GCCTGCGACATTATCAGCTGTGGAGAACATATCAATTCTGAAAGAGCTGAATGGACTTGGGAGACCGTCTGCCATAGCACGAATCATAATTAATTGA
AA sequence Show only first row Show all	>Lus10011047 pacid=23148649 polypeptide=Lus10011047 locus=Lus10011047.g ID=Lus10011047.BGIv1.0 annot-version=v1.0 MAKAMVSSIDVGTLQSWVEDEDGVSLYVLRRLKTVEVKNLKGTRHEITWIQWLLKSSPVLDEMEITLPATLSAVENISILKELNGLGRPSAIARIIIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011047 [exp]	0	1
					Lus10023773 [exp]	1.0	0.9485
AT4G01260	GeBP		DNA-binding storekeeper protei...		Lus10000807 [exp]	3.6	0.9094
AT1G13570			F-box/RNI-like superfamily pro...		Lus10011048 [exp]	4.9	0.9415
AT5G18100		CSD3	copper/zinc superoxide dismuta...		Lus10013615 [exp]	5.2	0.8990
AT2G44920			Tetratricopeptide repeat (TPR)...		Lus10002712 [exp]	7.9	0.9294
AT1G07180		NDA1, ATNDI1	ARABIDOPSIS THALIANA INTERNAL ...		Lus10018248 [exp]	11.7	0.8846
AT1G22630			unknown protein		Lus10018614 [exp]	14.3	0.9210
AT4G14740			Plant protein of unknown funct...		Lus10002798 [exp]	14.9	0.9068
AT3G09860			unknown protein		Lus10023014 [exp]	15.2	0.8960
AT2G42220			Rhodanese/Cell cycle control p...		Lus10021032 [exp]	15.6	0.9235

Compare expression of checked genes

Lus10011047 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.