Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47890 155 / 4e-51 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003023 [exp] 197 / 3e-67 AT5G47890 155 / 4e-51 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Lus10040122 [exp] 170 / 9e-57 AT5G47890 150 / 8e-49 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Lus10030922 [exp] 169 / 4e-56 AT5G47890 149 / 2e-48 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G071900 [exp] 163 / 7e-54 AT5G47890 145 / 8e-47 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Potri.003G159100 [exp] 154 / 2e-50 AT5G47890 152 / 1e-49 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Potri.013G126200 [exp] 40 / 3e-05 AT3G59650 202 / 8e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF05047 [flax] [poplar] L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Representative CDS sequence Show only first row Show all	>Lus10011053 pacid=23148632 polypeptide=Lus10011053 locus=Lus10011053.g ID=Lus10011053.BGIv1.0 annot-version=v1.0 ATGGCGTGGAGAGGCCAGCTATCTAAGAATCTGAAGGAGCTACGTGTCCTTCTGTGCCAGTCTTCTCCTGCAAGCTCCTCCACCAGAGCTTTCGTAGAGA AGAATTACAAGGATCTCAAGACGCTTAACCCCAAACTCCCCATCTTGATCCGTGAGTGCAGTGGGATCGAGCCGCAGCTCTGGGCTAGATATGATATGGG CGTGGAGCGGGGCGTTCGCTTGGAGGGGAAAGACGAGGGACAGATCGAGAAGGCATTGGAAGAGCTTGTCAAAGTAGGTGCAGCCCTCAAGGCATGA
AA sequence Show only first row Show all	>Lus10011053 pacid=23148632 polypeptide=Lus10011053 locus=Lus10011053.g ID=Lus10011053.BGIv1.0 annot-version=v1.0 MAWRGQLSKNLKELRVLLCQSSPASSSTRAFVEKNYKDLKTLNPKLPILIRECSGIEPQLWARYDMGVERGVRLEGKDEGQIEKALEELVKVGAALKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10011053 [exp]	0	1
AT2G16920		UBC23 ,PFU2	PHO2 FAMILY UBIQUITIN CONJUGAT...		Lus10037778 [exp]	4.5	0.7820
AT5G18850			unknown protein		Lus10033997 [exp]	4.6	0.8631
AT2G31200		ADF6, ATADF6	actin depolymerizing factor 6 ...		Lus10022933 [exp]	9.0	0.8212
AT1G58170			Disease resistance-responsive ...		Lus10026176 [exp]	9.4	0.8129
AT4G25225			unknown protein		Lus10038922 [exp]	10.0	0.7576
AT2G24940		ATMAPR2	membrane-associated progestero...		Lus10002241 [exp]	12.4	0.7841
AT5G47830			unknown protein		Lus10024804 [exp]	12.4	0.7671
AT1G67350			unknown protein		Lus10037020 [exp]	13.4	0.8218
AT4G35040	bZIP	bZIP19	Basic-leucine zipper (bZIP) tr...		Lus10005073 [exp]	22.6	0.7879
AT3G18410			Complex I subunit NDUFS6 (.1.2...		Lus10009027 [exp]	22.9	0.7946

Compare expression of checked genes

Lus10011053 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.