Lus10011056 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G59960 324 / 9e-111 NAD(P)-linked oxidoreductase superfamily protein (.1)
AT1G59950 301 / 1e-101 NAD(P)-linked oxidoreductase superfamily protein (.1)
AT2G37790 248 / 6e-81 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1)
AT2G37770 238 / 6e-77 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
AT2G37760 234 / 1e-75 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein
AT5G62420 233 / 3e-75 NAD(P)-linked oxidoreductase superfamily protein (.1)
AT3G53880 228 / 4e-73 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1)
AT5G01670 221 / 2e-70 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
AT2G21260 184 / 7e-56 NAD(P)-linked oxidoreductase superfamily protein (.1)
AT2G21250 179 / 3e-54 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030946 476 / 1e-170 AT1G59960 317 / 1e-107 NAD(P)-linked oxidoreductase superfamily protein (.1)
Lus10010720 332 / 1e-113 AT1G59960 410 / 2e-144 NAD(P)-linked oxidoreductase superfamily protein (.1)
Lus10029208 328 / 3e-112 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1)
Lus10027216 254 / 3e-83 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1)
Lus10000671 247 / 1e-82 AT1G59960 112 / 2e-30 NAD(P)-linked oxidoreductase superfamily protein (.1)
Lus10031739 250 / 1e-81 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1)
Lus10031162 250 / 1e-81 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1)
Lus10010885 235 / 8e-76 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Lus10010884 228 / 5e-73 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G193100 343 / 4e-118 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1)
Potri.005G097000 332 / 1e-113 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1)
Potri.012G039901 246 / 3e-82 AT1G59960 201 / 1e-64 NAD(P)-linked oxidoreductase superfamily protein (.1)
Potri.001G125400 245 / 1e-79 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1)
Potri.016G102032 234 / 3e-75 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Potri.006G090600 223 / 3e-71 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Potri.016G102300 223 / 5e-71 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Potri.016G102100 215 / 4e-68 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Potri.017G070600 212 / 7e-67 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Potri.008G144600 173 / 4e-51 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00248 Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence
>Lus10011056 pacid=23148700 polypeptide=Lus10011056 locus=Lus10011056.g ID=Lus10011056.BGIv1.0 annot-version=v1.0
ATGGACATCAAAGTTCCTGGTGGCGGTGTCCGGAAGATGCCGGCGGTCGGCATGGGAACCTCCGCCCACCCTTTACCGACGGAAGAAGTCATGGTCGCCA
CCTTCCTCGACGCCATCGAGGTGGGTTACCGCCACTTCGACACGGCGGCGCTCTACGGCTCCGAGGAAAGCGTGGGGAGAGCGGTGGCGGAAGCTGCGGA
TAAGGGACTCGTCGAGAGTCGTGACGAGTTCTTCATCACGTCCAAGGCTTGGTGTACTGATCTTTATCCGGAACTCGTCGTCCCGGCACTTAAAAACAGT
CTACGGAGGCTTGGGATGGAGTATGTTGATCTATACCTAGTACACTTCCCGGTAACGCTGAAGAACGATGCCAAGCCATTGGAGTTTGCCAAAGACGAGA
TCGTGGAGTTCGACATGAAGGGAGTATGGAATGCAATGGAAGAGTGTTACAAACAAGGCCTATGTAAAGCCATTGGTGTTAGCAACTTCGGTCCTGCAAA
GCTCTGTCAACTACTCGACTACGCAACCATCCCTCCTTCGGTTAACCAGGTTGAGATGAACGTGGGATGGCAACAAAAGGAACTGGTGGAGCTATGCAAA
CAAAAAGGAATTAGAGTTTGTGCATGGTCTCCACTTGCAGCCAATGGCGCTAATTGGGGCTCTTTCGCTGTTATGAAGAACCCCGTACTTCAGGAAATCG
CCGAAGCTAAGGGGAAGTCGATCTCACAGGTAGCATTGAGGTGGATATACGAGCAAGGAGTGATTCCGATAGTGAAGAGCTTCAACAAGGAAAGAATGAG
GCAAAACCTCGATATATTCAGCTGGCAACTAACAGAAAATGAAACTCTGAGGATCAAGCAGATTCCACAAAATCGAGGGTGGTCCGGGGAGTTGTTCGTC
TCCGAGACCGGTCCTTACAAGTCCACCGATGACCTCTGGAACCAACCCTTTCGAAACCTCTAG
AA sequence
>Lus10011056 pacid=23148700 polypeptide=Lus10011056 locus=Lus10011056.g ID=Lus10011056.BGIv1.0 annot-version=v1.0
MDIKVPGGGVRKMPAVGMGTSAHPLPTEEVMVATFLDAIEVGYRHFDTAALYGSEESVGRAVAEAADKGLVESRDEFFITSKAWCTDLYPELVVPALKNS
LRRLGMEYVDLYLVHFPVTLKNDAKPLEFAKDEIVEFDMKGVWNAMEECYKQGLCKAIGVSNFGPAKLCQLLDYATIPPSVNQVEMNVGWQQKELVELCK
QKGIRVCAWSPLAANGANWGSFAVMKNPVLQEIAEAKGKSISQVALRWIYEQGVIPIVKSFNKERMRQNLDIFSWQLTENETLRIKQIPQNRGWSGELFV
SETGPYKSTDDLWNQPFRNL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G59960 NAD(P)-linked oxidoreductase s... Lus10011056 0 1
Lus10000300 2.6 0.9357
AT1G14160 Uncharacterised protein family... Lus10037160 10.5 0.9456
AT3G23640 HGL1 heteroglycan glucosidase 1 (.1... Lus10035671 12.1 0.9396
AT1G14160 Uncharacterised protein family... Lus10036770 14.0 0.9377
Lus10006005 14.2 0.8826
AT1G65910 NAC ANAC028 NAC domain containing protein ... Lus10015554 15.3 0.8791
AT1G47710 Serine protease inhibitor (SER... Lus10005089 16.2 0.9435
AT1G80460 GLI1, NHO1 nonhost resistance to P. s. ph... Lus10035914 22.9 0.8950
AT1G35190 2-oxoglutarate (2OG) and Fe(II... Lus10043026 23.5 0.9382
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10024009 23.9 0.8714

Lus10011056 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.