Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011061 pacid=23148675 polypeptide=Lus10011061 locus=Lus10011061.g ID=Lus10011061.BGIv1.0 annot-version=v1.0 ATGCATGTAATCGTCGATATTAACCACTACGAGTCAGCAGAAGAGGGCTCGGATGAGCTGGCGGCGGGGGGCCTCGCCGGTCCTTGCCGGCGGGGCACGC ATTGCGATGCCACGAACGAACAAGAGGATAAGTGCGAATCAGTCCCTTTCTCTTAA
AA sequence Show only first row Show all	>Lus10011061 pacid=23148675 polypeptide=Lus10011061 locus=Lus10011061.g ID=Lus10011061.BGIv1.0 annot-version=v1.0 MHVIVDINHYESAEEGSDELAAGGLAGPCRRGTHCDATNEQEDKCESVPFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011061 [exp]	0	1
AT4G01830		ABCB5, PGP5	ATP-binding cassette B5, P-gly...		Lus10004529 [exp]	1.0	1.0000
					Lus10011759 [exp]	1.4	1.0000
AT2G20420			ATP citrate lyase (ACL) family...		Lus10024923 [exp]	1.7	1.0000
AT4G00750			S-adenosyl-L-methionine-depend...		Lus10027433 [exp]	2.0	1.0000
					Lus10013545 [exp]	2.2	1.0000
AT4G24975			Plant self-incompatibility pro...		Lus10032383 [exp]	2.4	1.0000
					Lus10017303 [exp]	2.6	1.0000
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10010756 [exp]	3.2	1.0000
AT3G11680			Aluminium activated malate tra...		Lus10013347 [exp]	3.5	1.0000
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10018417 [exp]	4.0	1.0000

Compare expression of checked genes

Lus10011061 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.