Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28280 50 / 9e-09 LLG3 LORELEI-LIKE-GPI ANCHORED PROTEIN 3 (.1.2) AT4G26466 49 / 2e-08 LRE lorelei (.1) AT2G20700 46 / 3e-07 LLG2 LORELEI-LIKE-GPI ANCHORED PROTEIN 2 (.1) AT5G56170 44 / 2e-06 LLG1 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000313 [exp] 211 / 1e-71 AT4G26466 55 / 2e-09 lorelei (.1) Lus10033694 [exp] 44 / 1e-06 AT5G56170 140 / 2e-43 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1) Lus10027120 [exp] 44 / 2e-06 AT5G56170 179 / 3e-58 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1) Lus10000404 [exp] 43 / 5e-06 AT5G56170 180 / 2e-58 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1) Lus10033695 [exp] 42 / 1e-05 AT5G56170 135 / 2e-41 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G095200 [exp] 50 / 8e-09 AT5G56170 153 / 7e-48 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1) Potri.013G132000 [exp] 48 / 6e-08 AT5G56170 159 / 2e-50 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1) Potri.001G471500 [exp] 43 / 6e-06 AT5G56170 183 / 8e-60 LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011066 pacid=23148679 polypeptide=Lus10011066 locus=Lus10011066.g ID=Lus10011066.BGIv1.0 annot-version=v1.0 ATGGATTACAGCGTGTTCGAGAGGAGTTGCCAAGGGGATCATCACACTTCTCGCAAGCAGTGTTGCGCGGCTTGGAAGTTGTTCGTGTGCCCCATTCGAC AGTACATAAGCGAAAGAACCGACTGTATGGACTATGTGTTCTATAACATCTACATGCACCACCCGACCATGGAACACGATTACTTCGCAAACTATTGTAA AGAACCAAGGAAGAAGGAACTCGATTGTCTACCCATCGACCAGTTCCTTATACATCACGGCAAGAATCCAGTCAAGGTCGCCTCTCCAATCCCAAACGAC CCGAGATACGGGAGGTAG
AA sequence Show only first row Show all	>Lus10011066 pacid=23148679 polypeptide=Lus10011066 locus=Lus10011066.g ID=Lus10011066.BGIv1.0 annot-version=v1.0 MDYSVFERSCQGDHHTSRKQCCAAWKLFVCPIRQYISERTDCMDYVFYNIYMHHPTMEHDYFANYCKEPRKKELDCLPIDQFLIHHGKNPVKVASPIPND PRYGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G26466		LRE	lorelei (.1)		Lus10011066 [exp]	0	1
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023036 [exp]	2.2	0.9188
AT3G18570			Oleosin family protein (.1)		Lus10032461 [exp]	2.4	0.8650
AT1G06340			Plant Tudor-like protein (.1)		Lus10039027 [exp]	3.2	0.9188
					Lus10010518 [exp]	3.5	0.7198
AT2G44220			Protein of Unknown Function (D...		Lus10006862 [exp]	3.9	0.9188
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10020358 [exp]	4.5	0.6391
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10026169 [exp]	4.5	0.9188
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10018718 [exp]	5.0	0.9188
AT5G28823			unknown protein		Lus10040056 [exp]	6.5	0.7911
AT3G60680			Plant protein of unknown funct...		Lus10034935 [exp]	6.9	0.7597

Compare expression of checked genes

Lus10011066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.