Lus10011069 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16970 88 / 6e-23 Plant self-incompatibility protein S1 family (.1)
AT4G16195 87 / 3e-22 Plant self-incompatibility protein S1 family (.1)
AT1G04645 85 / 4e-22 Plant self-incompatibility protein S1 family (.1)
AT3G17080 83 / 4e-21 Plant self-incompatibility protein S1 family (.1)
AT5G12060 77 / 1e-18 Plant self-incompatibility protein S1 family (.1)
AT4G24973 74 / 9e-18 Plant self-incompatibility protein S1 family (.1)
AT4G24974 74 / 1e-17 Plant self-incompatibility protein S1 family (.1)
AT5G12070 73 / 4e-17 Plant self-incompatibility protein S1 family (.1)
AT4G24975 73 / 4e-17 Plant self-incompatibility protein S1 family (.1)
AT1G26795 71 / 4e-16 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011068 181 / 1e-59 AT4G16195 103 / 5e-29 Plant self-incompatibility protein S1 family (.1)
Lus10030965 95 / 2e-25 AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
Lus10030964 93 / 5e-25 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1)
Lus10008107 92 / 2e-24 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1)
Lus10000480 89 / 1e-23 AT5G12060 84 / 7e-22 Plant self-incompatibility protein S1 family (.1)
Lus10030565 85 / 1e-21 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1)
Lus10013145 78 / 4e-19 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1)
Lus10017929 68 / 2e-15 AT4G16195 71 / 1e-16 Plant self-incompatibility protein S1 family (.1)
Lus10011753 70 / 4e-15 AT3G16970 90 / 1e-22 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G148630 87 / 2e-22 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 80 / 5e-20 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 71 / 3e-16 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.017G144361 70 / 1e-15 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1)
Potri.018G148700 68 / 4e-15 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 63 / 4e-13 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 58 / 3e-11 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.002G252500 49 / 9e-08 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.016G066900 47 / 2e-07 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 45 / 3e-06 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10011069 pacid=23148648 polypeptide=Lus10011069 locus=Lus10011069.g ID=Lus10011069.BGIv1.0 annot-version=v1.0
ATGGCGACAACGGCGATGGTGGCAGCAGTAGTGACAATGATGATGATGATGATGATTGTGTCAACAACTGACGGACAGCTCGTGAAAACGGACGTCACGA
TATACAACTTTCTGGATGGCGGGCTGGACCTGTACGTGCACTGCAAGTCGAAAGATGACGACTTGGGGAAACACTTGTTGTCCTCGAAACAAAGATGGGG
ATTTCGTTTCGGCCCCAACGTTTTCGAGAACACGCTGTTTTTCTGCTCGTTCGACTGGGCTGGCAACCCGGACGGGTTGAGCTACTTCGATATTTACAAG
CAGAAGAGGGACGAGAAGCTTTGTGGAACAGACTGTATATGGCTTGTACATCAGACGGGAGTTTGCTTGTTTAAGCCAAGTTCCAATGGTTATTATACTA
CTTGTTTCCCTTATAATAAAAAGCTAAGTTAA
AA sequence
>Lus10011069 pacid=23148648 polypeptide=Lus10011069 locus=Lus10011069.g ID=Lus10011069.BGIv1.0 annot-version=v1.0
MATTAMVAAVVTMMMMMMIVSTTDGQLVKTDVTIYNFLDGGLDLYVHCKSKDDDLGKHLLSSKQRWGFRFGPNVFENTLFFCSFDWAGNPDGLSYFDIYK
QKRDEKLCGTDCIWLVHQTGVCLFKPSSNGYYTTCFPYNKKLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16195 Plant self-incompatibility pro... Lus10011069 0 1
AT1G28030 2-oxoglutarate (2OG) and Fe(II... Lus10012760 5.3 0.9417
AT5G42230 SCPL41 serine carboxypeptidase-like 4... Lus10023444 7.5 0.9369
Lus10000178 9.0 0.7569
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 10.5 0.9300
Lus10021782 12.2 0.9300
AT3G15280 unknown protein Lus10009211 12.4 0.6266
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 13.6 0.9300
AT3G19540 Protein of unknown function (D... Lus10028040 14.9 0.9300
Lus10007927 16.1 0.9300
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 17.2 0.9300

Lus10011069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.