Lus10011078 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036641 70 / 3e-16 ND /
Lus10036295 68 / 6e-15 ND /
Lus10009869 66 / 9e-15 ND /
Lus10001186 66 / 2e-13 ND /
Lus10016933 62 / 2e-13 ND /
Lus10021734 61 / 5e-13 ND /
Lus10010841 60 / 2e-11 AT2G37640 373 / 6e-127 ARABIDOPSIS THALIANA EXPANSIN A3, EXPANSIN 3, Barwin-like endoglucanases superfamily protein (.1)
Lus10006503 60 / 2e-11 ND /
Lus10007182 57 / 2e-11 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011078 pacid=23165730 polypeptide=Lus10011078 locus=Lus10011078.g ID=Lus10011078.BGIv1.0 annot-version=v1.0
ATGATGCATTGTGTAGGAGTTATTCTGCAGAAATCAAGCACACATCAACTTCTATTGCATCAAATGGATCTAATTCGAGTGCTTGGTTTGAGTTCAAGCA
ACACACAAATTCTTTTCCCTCCTAGAGTTCAAGTCGATGACTGGTTCATGCGACAGTTTGCGAAACTTATGCTTGCAAAGTTTGATAAGCAAAGTGGTAC
TCTCTCTCCTAAGTTGCATCAAAAAGGAAAGAAGGTTCTGCACCGGGCTCATCTGGAGCTTCTGGATCATTGGGAGCTTTCAAAGGAAGGAGACATGACG
ATAGCAGCCCGCCCGATGAGTCTGAGGAGGAGGAGGAGGATATTGAAGATGAGTAGGTCGTTAGTAGGTTATGTTATTAGTATATTATTGTCTTTCTAA
AA sequence
>Lus10011078 pacid=23165730 polypeptide=Lus10011078 locus=Lus10011078.g ID=Lus10011078.BGIv1.0 annot-version=v1.0
MMHCVGVILQKSSTHQLLLHQMDLIRVLGLSSSNTQILFPPRVQVDDWFMRQFAKLMLAKFDKQSGTLSPKLHQKGKKVLHRAHLELLDHWELSKEGDMT
IAARPMSLRRRRRILKMSRSLVGYVISILLSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011078 0 1
AT5G22450 unknown protein Lus10000530 1.7 1.0000
Lus10011642 2.2 1.0000
Lus10022214 2.4 1.0000
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10003908 3.0 1.0000
Lus10027991 3.2 1.0000
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Lus10013028 3.3 1.0000
Lus10003536 3.5 1.0000
Lus10035592 4.7 1.0000
AT5G54010 UDP-Glycosyltransferase superf... Lus10039237 4.9 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10022902 5.3 1.0000

Lus10011078 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.