Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67385 60 / 5e-12 Phototropic-responsive NPH3 family protein (.1) AT3G49970 52 / 4e-09 Phototropic-responsive NPH3 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014858 [exp] 142 / 7e-42 AT5G67385 489 / 2e-168 Phototropic-responsive NPH3 family protein (.1) Lus10019290 [exp] 59 / 1e-11 AT5G67385 402 / 6e-135 Phototropic-responsive NPH3 family protein (.1) Lus10011532 [exp] 52 / 4e-09 AT5G67385 427 / 2e-144 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G053200 [exp] 71 / 6e-16 AT5G67385 807 / 0.0 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011081 pacid=23165731 polypeptide=Lus10011081 locus=Lus10011081.g ID=Lus10011081.BGIv1.0 annot-version=v1.0 ATGAAGATGAAGGAAGTTGAGAAATCTACTAATCCTGCTGCTAGATCAACATCAGGCAGTCCAATGTCGTCAATTAACTCCCGTTCTGCGGACAACCCTC CTCTTCCCCCGAATAAAAAGTCATTCATCAACTCTGTATCAAAGAAGCTAGGAAAACTCATGCGGCCTGAAGGACTCTCAACATCCAGATCTCGAACCAA ACCTCCTAAAGATAGGCGCCATTCTATATCTCGAGACATCAGTAACTGA
AA sequence Show only first row Show all	>Lus10011081 pacid=23165731 polypeptide=Lus10011081 locus=Lus10011081.g ID=Lus10011081.BGIv1.0 annot-version=v1.0 MKMKEVEKSTNPAARSTSGSPMSSINSRSADNPPLPPNKKSFINSVSKKLGKLMRPEGLSTSRSRTKPPKDRRHSISRDISN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G67385			Phototropic-responsive NPH3 fa...		Lus10011081 [exp]	0	1
AT5G67385			Phototropic-responsive NPH3 fa...		Lus10011082 [exp]	1.0	0.9732
AT5G02440			unknown protein		Lus10025345 [exp]	2.0	0.8734
					Lus10018660 [exp]	5.3	0.8546
AT2G01940	C2H2ZnF	SGR5, ATIDD15	SHOOT GRAVITROPISM 5, ARABIDOP...		Lus10026369 [exp]	11.4	0.7979
AT5G02440			unknown protein		Lus10024400 [exp]	11.6	0.8473
AT4G18240		ATSS4, SSIV	ARABIDOPSIS THALIANA STARCH SY...		Lus10028133 [exp]	13.0	0.8456
AT3G59780			Rhodanese/Cell cycle control p...		Lus10027050 [exp]	22.8	0.8622
AT2G39470		PnsL1, PPL2	Photosynthetic NDH subcomplex...		Lus10040314 [exp]	24.9	0.8466
AT3G43600		AtAO3, atAO-2, ...	Arabidopsis thaliana aldehyde ...		Lus10023586 [exp]	25.9	0.7916
AT5G13790	MADS	AGL15	AGAMOUS-like 15 (.1)		Lus10039580 [exp]	27.7	0.7900

Compare expression of checked genes

Lus10011081 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.