Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33910 120 / 4e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G23096 109 / 4e-31 P4H13 prolyl 4-hydroxylase 13, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 74 / 3e-17 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G20270 72 / 7e-17 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G28480 71 / 3e-16 Oxoglutarate/iron-dependent oxygenase (.1.2) AT3G28490 69 / 2e-15 Oxoglutarate/iron-dependent oxygenase (.1) AT5G18900 68 / 3e-15 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G35810 62 / 3e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G43080 62 / 4e-13 AT-P4H-1 P4H isoform 1 (.1) AT2G17720 61 / 1e-12 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032184 [exp] 72 / 1e-17 AT3G28480 206 / 2e-67 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10032183 [exp] 74 / 2e-17 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10028404 [exp] 71 / 2e-16 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041857 [exp] 71 / 2e-16 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10014502 [exp] 68 / 4e-15 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10016271 [exp] 65 / 4e-14 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10012014 [exp] 65 / 7e-14 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10020969 [exp] 62 / 1e-13 AT4G33910 91 / 2e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005620 [exp] 62 / 5e-13 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G296800 [exp] 119 / 8e-35 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G091000 [exp] 119 / 1e-34 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G052600 [exp] 100 / 1e-27 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G060800 [exp] 70 / 7e-16 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G075100 [exp] 70 / 8e-16 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.017G075300 [exp] 68 / 3e-15 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.005G245300 [exp] 67 / 4e-15 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G108000 [exp] 67 / 6e-15 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.008G197700 [exp] 66 / 1e-14 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G232100 [exp] 58 / 1e-11 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011084 pacid=23165718 polypeptide=Lus10011084 locus=Lus10011084.g ID=Lus10011084.BGIv1.0 annot-version=v1.0 ATGTTCCCATTTGAGAACGGGATCAGCAGTCCAGAAAATTATAATTTCAAAGAATGCATTGGATTGAAAGTGAAACCAAGGCAGGGCGATGGGCTTCTTT TCTACTCGCTACTCCCAAATAACACAATTGACCCGACATCACTTCATGGCAGTTGCTCAGTAACAAAAGGGGAGAAATGGGTGGCAACCAAATGGATCAG AAACGAAGAACAAACCGATGATGCGGACTGA
AA sequence Show only first row Show all	>Lus10011084 pacid=23165718 polypeptide=Lus10011084 locus=Lus10011084.g ID=Lus10011084.BGIv1.0 annot-version=v1.0 MFPFENGISSPENYNFKECIGLKVKPRQGDGLLFYSLLPNNTIDPTSLHGSCSVTKGEKWVATKWIRNEEQTDDAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33910			2-oxoglutarate (2OG) and Fe(II...		Lus10011084 [exp]	0	1
AT5G15730		CRLK2, AtCRLK2	calcium/calmodulin-regulated r...		Lus10008540 [exp]	5.2	0.9057
AT3G10150		ATPAP16, PAP16	purple acid phosphatase 16 (.1...		Lus10018030 [exp]	5.5	0.9080
AT4G39230			NmrA-like negative transcripti...		Lus10023557 [exp]	7.2	0.8897
AT3G10915			Reticulon family protein (.1.2...		Lus10034224 [exp]	8.3	0.9185
AT2G17290		ATCPK6, ATCDPK3...	calcium dependent protein kina...		Lus10013842 [exp]	15.6	0.8815
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10013287 [exp]	16.9	0.9044
AT1G27430			GYF domain-containing protein ...		Lus10035192 [exp]	17.9	0.8787
AT1G07570		APK1A	Protein kinase superfamily pro...		Lus10002697 [exp]	21.6	0.9043
AT4G14640		CAM8, AtCML8	calmodulin-like 8, calmodulin ...		Lus10039391 [exp]	22.1	0.8916
AT1G74790			catalytics (.1)		Lus10036662 [exp]	23.1	0.8889

Compare expression of checked genes

Lus10011084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.