Lus10011085 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33910 228 / 4e-74 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G23096 164 / 4e-49 P4H13 prolyl 4-hydroxylase 13, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G20270 105 / 2e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G66060 101 / 4e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G17720 100 / 1e-24 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G35810 94 / 3e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G28490 93 / 5e-22 Oxoglutarate/iron-dependent oxygenase (.1)
AT3G28480 88 / 7e-20 Oxoglutarate/iron-dependent oxygenase (.1.2)
AT2G43080 85 / 6e-19 AT-P4H-1 P4H isoform 1 (.1)
AT3G06300 84 / 9e-19 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028404 110 / 3e-28 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10041857 108 / 1e-27 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10012014 93 / 1e-21 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016271 93 / 1e-21 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10032183 90 / 1e-20 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10014502 89 / 2e-20 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10031048 87 / 4e-20 AT2G43080 406 / 7e-145 P4H isoform 1 (.1)
Lus10005620 89 / 5e-20 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10017249 88 / 9e-20 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G052600 245 / 1e-80 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G296800 234 / 2e-76 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.009G091000 218 / 4e-70 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G245300 104 / 4e-26 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G108000 97 / 1e-23 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.007G060800 95 / 2e-22 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.008G197700 92 / 1e-21 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G232100 91 / 3e-21 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
Potri.017G075300 90 / 8e-21 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2)
Potri.017G075100 89 / 3e-20 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2)
PFAM info
Representative CDS sequence
>Lus10011085 pacid=23165720 polypeptide=Lus10011085 locus=Lus10011085.g ID=Lus10011085.BGIv1.0 annot-version=v1.0
ATGAAACCCGTCAAACCTTCCAGGGCCCACTTCTTCCTCAAGCTTAGAGGGAAGTTAGGGTTACCTGCCATCTTCATTTGCTTCTTGTTCTTCTTCCTCG
CCGGCCTTTTTGCCTCCAATCTTATCTCTCAGGAGGATCCTGGTCTGACGTCCAACTCCCGTAAGCTGCAGTCTTCGTTGCTGGAGACGAAGAAATTCGA
GTACAATTTACTCCCTCCGGGACAGTCTGGCGATGATTCCATCACGCTTATCCCTTTCCAGGTCCTGAGCTGGAAACCTCGTGCTTTGTACTTTCCCAAC
TTTGCCTCTGCAGAGCAATGTGAAAGTATAATTAGTATGGCAAAGCCACATCTAAAGCCGTCAACTTTGGCTTTACGCAAGGGAGAAACAGAAGAGAGTA
CGGAGGGAGTAAGAACAAGCTCTGGTGTGTTCCTCAGTTCTTCTGAAGATGACACAGGCGTCTTGGATGTGATCGAAGAAAAAATTGCTAGAGCGAGTAT
GATTCCAAGGGCCCATGGAGAGGCATTCAATATTCTTCGTTATGAGGTTGGCCAAAAGTATGATTCTCACTATGATGCGTTCAATCCTTCAGAATATGGT
CCACAAAAGAGTCAACGGATAACTTATATTCCATACATGAATTTGCTGGTCCACAACAACATGAATACCTGTAAAATCAGCCTTATGGAAGGCGCGATTA
GGCGTCCGCCTAGACGAGAAAAACCCCAAGGCACCGGCAAAACGCCTCGCCTCGGGCAAGGCGATGAAATAAGGATGTCGACCGAAGAATCACTAAGGAA
GAGCGAAATCGATGAGGGATCGATTTCCTGCGACGCCGAGGCGGCGAAATCTGCTATTAGGCGTTAA
AA sequence
>Lus10011085 pacid=23165720 polypeptide=Lus10011085 locus=Lus10011085.g ID=Lus10011085.BGIv1.0 annot-version=v1.0
MKPVKPSRAHFFLKLRGKLGLPAIFICFLFFFLAGLFASNLISQEDPGLTSNSRKLQSSLLETKKFEYNLLPPGQSGDDSITLIPFQVLSWKPRALYFPN
FASAEQCESIISMAKPHLKPSTLALRKGETEESTEGVRTSSGVFLSSSEDDTGVLDVIEEKIARASMIPRAHGEAFNILRYEVGQKYDSHYDAFNPSEYG
PQKSQRITYIPYMNLLVHNNMNTCKISLMEGAIRRPPRREKPQGTGKTPRLGQGDEIRMSTEESLRKSEIDEGSISCDAEAAKSAIRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33910 2-oxoglutarate (2OG) and Fe(II... Lus10011085 0 1
AT4G18270 ATTRANS11 ARABIDOPSIS THALIANA TRANSLOCA... Lus10038493 12.3 0.6840
AT1G28380 NSL1 necrotic spotted lesions 1, MA... Lus10021803 13.0 0.7399
AT5G53870 AtENODL1 early nodulin-like protein 1 (... Lus10009196 20.6 0.6383
AT4G24620 PGI1 phosphoglucose isomerase 1 (.1... Lus10015959 29.8 0.7147
AT4G09510 A/N-InvI, CINV2 alkaline/neutral invertase I, ... Lus10006078 30.0 0.7112
AT3G17205 UPL6 ubiquitin protein ligase 6 (.1... Lus10017098 30.4 0.7260
AT5G18480 PGSIP6 plant glycogenin-like starch i... Lus10000817 35.0 0.7387
AT4G02570 AXR6, ATCUL1 AUXIN RESISTANT 6, cullin 1 (.... Lus10028917 41.0 0.7021
AT1G29050 TBL38 TRICHOME BIREFRINGENCE-LIKE 38... Lus10000988 56.6 0.6851
AT5G40450 unknown protein Lus10022266 59.9 0.7129

Lus10011085 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.