Lus10011090 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 155 / 7e-48 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 117 / 2e-32 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 102 / 1e-26 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 74 / 4e-16 ATDR4 drought-repressed 4 (.1)
AT1G72290 49 / 5e-07 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013732 343 / 2e-121 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039208 341 / 7e-121 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 317 / 2e-111 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 308 / 6e-108 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 307 / 3e-107 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 304 / 6e-106 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013731 307 / 7e-106 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 302 / 1e-103 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10026357 295 / 2e-102 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 189 / 7e-61 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 187 / 3e-60 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 182 / 3e-58 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 174 / 5e-55 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 174 / 8e-55 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 160 / 9e-50 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 132 / 1e-38 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 83 / 1e-19 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 76 / 8e-17 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G000400 75 / 2e-16 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10011090 pacid=23167552 polypeptide=Lus10011090 locus=Lus10011090.g ID=Lus10011090.BGIv1.0 annot-version=v1.0
ATGAAGACACTTACAATATCTTCATTCACCATAGTCCTCCTTGTCTCCTTTACCACACTTTCATCCGCAGCATCATCCCCGACTCCGGTCACTGACATTG
ATGGTGCACCCCTCCGATTGGGCCGCAAGTACTTCATCCTCCCATCTGTCTCCGGAAACGGGGGCGGCCTCGCTCTAGGCAGAAGAACCGATACAAAGAA
ATGCCCGCTCTCCGTGATTCAGGACGAACACGAGCTCTCCAAGGGTATCCCGGTAGTTTTTCTGCCCATCAACGCCAAGCCGGGCTACATCGTTCGAACG
GACACCGATCTCAACATCGAGTTCACGGTCGAGACTGCCTGCAACGAAGCCCCCGTGTGGAAGGTGGAGAGTTATGACCATGACGTCAGGCAGTGGTTCA
TTGGCACCGGTGGTATCGAAGGAAAGCCCGGTCCTAGGACTGTGGACAACTGGTTTAAGATTGCAAAATACGGCGGGAACTACAAGCTCGTGTACTGCCC
TTCTGTGTGCAAGAGTTGCAAGGTTCAGTGTAAGGATGTCGGGGTTTATGTGGATGAATATGGCAAGAAGAGGCTTGCTTTTCCTACTGACGATGAGCCT
TCCATTGTTAAGTTCATGAAAGCTCCTAAATAG
AA sequence
>Lus10011090 pacid=23167552 polypeptide=Lus10011090 locus=Lus10011090.g ID=Lus10011090.BGIv1.0 annot-version=v1.0
MKTLTISSFTIVLLVSFTTLSSAASSPTPVTDIDGAPLRLGRKYFILPSVSGNGGGLALGRRTDTKKCPLSVIQDEHELSKGIPVVFLPINAKPGYIVRT
DTDLNIEFTVETACNEAPVWKVESYDHDVRQWFIGTGGIEGKPGPRTVDNWFKIAKYGGNYKLVYCPSVCKSCKVQCKDVGVYVDEYGKKRLAFPTDDEP
SIVKFMKAPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10011090 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10013732 1.0 0.9788
AT1G17860 Kunitz family trypsin and prot... Lus10039208 1.4 0.9755
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10013332 1.7 0.9722
AT1G14550 Peroxidase superfamily protein... Lus10009898 2.0 0.9670
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10024511 5.0 0.9670
AT3G26270 CYP71B25 "cytochrome P450, family 71, s... Lus10019463 6.7 0.9639
Lus10022008 8.5 0.9658
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10043308 10.6 0.9642
Lus10027915 10.8 0.9574
Lus10028589 11.0 0.9426

Lus10011090 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.