Lus10011094 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55980 40 / 2e-05 serine-rich protein-related (.1)
AT3G13227 39 / 6e-05 serine-rich protein-related (.1)
AT1G67910 38 / 8e-05 unknown protein
AT5G20370 39 / 0.0002 serine-rich protein-related (.1)
AT3G56500 36 / 0.0008 serine-rich protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023632 50 / 3e-09 AT1G67910 48 / 1e-08 unknown protein
Lus10043215 48 / 2e-08 AT5G55980 44 / 8e-07 serine-rich protein-related (.1)
Lus10034901 45 / 2e-07 AT1G67910 49 / 6e-09 unknown protein
Lus10008880 38 / 0.0002 AT5G55980 63 / 1e-13 serine-rich protein-related (.1)
Lus10023227 38 / 0.0002 AT5G55980 69 / 3e-16 serine-rich protein-related (.1)
Lus10000442 37 / 0.0004 AT1G67910 56 / 1e-11 unknown protein
Lus10026701 37 / 0.0004 AT1G67910 56 / 5e-12 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G079200 44 / 7e-07 AT1G67910 45 / 9e-08 unknown protein
Potri.001G371400 40 / 5e-05 AT5G55980 50 / 2e-08 serine-rich protein-related (.1)
Potri.010G046700 38 / 0.0001 AT1G67910 82 / 4e-22 unknown protein
Potri.008G186200 38 / 0.0002 AT1G67910 85 / 4e-23 unknown protein
Potri.018G078900 36 / 0.0006 AT3G13227 42 / 3e-06 serine-rich protein-related (.1)
Potri.006G159300 36 / 0.0008 AT1G24577 43 / 5e-07 unknown protein
PFAM info
Representative CDS sequence
>Lus10011094 pacid=23167518 polypeptide=Lus10011094 locus=Lus10011094.g ID=Lus10011094.BGIv1.0 annot-version=v1.0
ATGGGTTCCAACGCCGGCAGCCTGACAGTTTCCACAGCCTCCCCTAAAGGCGGCGGCGGCGGCGATGGAAGCGGCACTGCCGCTGGAGGTGGTGGTCAGT
GCCTGTGCTCGCCAACGACGCATAAGGGATCGTTCAGGTGCAGATTCCATGGAGCTTCTTCCTCTGCTTTGAGTAAGAAGATGATGAAGAGATCATATTC
CATGCCTGCTAATAATAATATTTCTTCTTCTTCTTCTTCTATTGCTCCTGATTCCTCCGCCTCCTTGGCCTGTATTTCTCCCGAATCCGTTGAATCAACT
TAG
AA sequence
>Lus10011094 pacid=23167518 polypeptide=Lus10011094 locus=Lus10011094.g ID=Lus10011094.BGIv1.0 annot-version=v1.0
MGSNAGSLTVSTASPKGGGGGDGSGTAAGGGGQCLCSPTTHKGSFRCRFHGASSSALSKKMMKRSYSMPANNNISSSSSSIAPDSSASLACISPESVEST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55980 serine-rich protein-related (.... Lus10011094 0 1
AT2G39130 Transmembrane amino acid trans... Lus10039190 2.0 0.9434
AT4G20260 ATPCAP1 ARABIDOPSIS THALIANA PLASMA-ME... Lus10036243 11.3 0.9325
AT1G10070 ATBCAT-2 branched-chain amino acid tran... Lus10007247 11.4 0.9450
AT3G27020 YSL6 YELLOW STRIPE like 6 (.1) Lus10041544 14.8 0.9253
AT3G60340 alpha/beta-Hydrolases superfam... Lus10004375 17.8 0.9423
AT5G53160 RCAR3, PYL8 PYR1-like 8, regulatory compon... Lus10039335 20.9 0.9365
AT2G23450 Protein kinase superfamily pro... Lus10032741 21.3 0.9386
AT1G13195 RING/U-box superfamily protein... Lus10006253 29.9 0.9344
AT3G26935 DHHC-type zinc finger family p... Lus10016754 31.1 0.9249
AT5G38710 Methylenetetrahydrofolate redu... Lus10034094 32.6 0.9194

Lus10011094 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.