Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24530 250 / 9e-82 AAA-type ATPase family protein / ankyrin repeat family protein (.1) AT4G19150 68 / 5e-14 Ankyrin repeat family protein (.1.2) AT2G14255 62 / 3e-11 Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT2G03430 59 / 1e-10 Ankyrin repeat family protein (.1) AT5G20350 58 / 5e-10 TIP1 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT2G28840 55 / 5e-09 XBAT31 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) AT4G27780 54 / 1e-08 ACBP2 acyl-CoA binding protein 2 (.1) AT1G14480 49 / 4e-07 Ankyrin repeat family protein (.1.2) AT5G66055 49 / 5e-07 EMB16, EMB2036, AKRP EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) AT5G57740 49 / 6e-07 XBAT32 XB3 ortholog 2 in Arabidopsis thaliana (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043218 [exp] 349 / 3e-120 AT3G24530 743 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Lus10023642 [exp] 313 / 2e-106 AT3G24530 773 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Lus10034913 [exp] 312 / 2e-105 AT3G24530 748 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Lus10001414 [exp] 72 / 3e-15 AT4G19150 245 / 9e-82 Ankyrin repeat family protein (.1.2) Lus10001048 [exp] 65 / 2e-12 AT4G19150 230 / 6e-76 Ankyrin repeat family protein (.1.2) Lus10016561 [exp] 64 / 5e-12 AT2G28840 640 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Lus10041853 [exp] 52 / 9e-08 AT5G66055 465 / 2e-162 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Lus10022382 [exp] 50 / 2e-07 AT4G27780 432 / 2e-152 acyl-CoA binding protein 2 (.1) Lus10037116 [exp] 49 / 3e-07 AT2G03430 284 / 2e-97 Ankyrin repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G081000 [exp] 284 / 7e-95 AT3G24530 754 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Potri.006G158600 [exp] 275 / 4e-91 AT3G24530 741 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Potri.003G103400 [exp] 83 / 2e-19 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2) Potri.001G130500 [exp] 79 / 5e-18 AT4G19150 222 / 1e-72 Ankyrin repeat family protein (.1.2) Potri.001G238800 [exp] 60 / 1e-10 AT2G28840 657 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Potri.005G105800 [exp] 57 / 1e-09 AT5G66055 457 / 3e-159 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Potri.010G185200 [exp] 56 / 2e-09 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.015G010200 [exp] 56 / 3e-09 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1) Potri.007G060400 [exp] 53 / 3e-08 AT5G66055 462 / 2e-161 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Potri.012G017700 [exp] 53 / 3e-08 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [flax] [poplar] Ank PF00023 [flax] [poplar] Ank Ankyrin repeat
Representative CDS sequence Show only first row Show all	>Lus10011097 pacid=23167528 polypeptide=Lus10011097 locus=Lus10011097.g ID=Lus10011097.BGIv1.0 annot-version=v1.0 ATGCAGAGGCCTTCCCAGGGTCAACGGACTAGCTCTTCTAAGCCCGCCACTATTCACGCCTTCGTCCAGTCCGGCGACCTTCCCGCCGTCCAGAAGCTGC TACGTGGCAACCCTTCTCTTCTCAATGACAGAAACCCTGTTATGTCGCAGACTCCTCTACATGTTTCAGCTGGAAACAACAAGGGGGAAATCGTGAAATT TCTGCTGTGTTGGAAAGGTGATGAGAAGGTTGAATTGGAAGCTAAAAACATGTATGGGGAAACTCCACTGCACATGGCAGCAAAGAACGGCTGCAAAGAA GCTGCACAGTTACTCCTTTCTCATGGCGCTTTCATTGAGGCCAGAGCAAATAATGGTATGACTCCATTGCACCTAGCTGTTTGGTACTCTATAAGATCAG ATGATTGCTTGACTGTCAAGACATTGCTAGAGTACAATGCTGATTGCAGTGCAAAGGACAATGAGGGCATGGCTCCTCTGAACCATCTCTCGCACGGGCC AGGCAGCGAGAAGCTGCGGGGATCTATTGAACCATTACGTCGAAGAGCAGAAAAGGAGGAAAGCAGTCGAAGCATGCAGTGA
AA sequence Show only first row Show all	>Lus10011097 pacid=23167528 polypeptide=Lus10011097 locus=Lus10011097.g ID=Lus10011097.BGIv1.0 annot-version=v1.0 MQRPSQGQRTSSSKPATIHAFVQSGDLPAVQKLLRGNPSLLNDRNPVMSQTPLHVSAGNNKGEIVKFLLCWKGDEKVELEAKNMYGETPLHMAAKNGCKE AAQLLLSHGAFIEARANNGMTPLHLAVWYSIRSDDCLTVKTLLEYNADCSAKDNEGMAPLNHLSHGPGSEKLRGSIEPLRRRAEKEESSRSMQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24530			AAA-type ATPase family protein...		Lus10011097 [exp]	0	1
AT3G24530			AAA-type ATPase family protein...		Lus10011096 [exp]	1.7	0.8776
AT4G17970		ATALMT12, ALMT1...	"aluminum-activated, malate tr...		Lus10000898 [exp]	20.5	0.8610
AT5G35180			Protein of unknown function (D...		Lus10040015 [exp]	23.6	0.8148
AT5G51310			2-oxoglutarate (2OG) and Fe(II...		Lus10018836 [exp]	27.5	0.8598
AT5G42320			Zn-dependent exopeptidases sup...		Lus10016010 [exp]	32.4	0.8188
AT2G48030			DNAse I-like superfamily prote...		Lus10027979 [exp]	34.3	0.8562
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10033072 [exp]	54.3	0.8246
AT3G21780		UGT71B6	UDP-glucosyl transferase 71B6 ...		Lus10026793 [exp]	58.5	0.8473
AT5G35570			O-fucosyltransferase family pr...		Lus10021557 [exp]	77.9	0.7837
AT3G61260			Remorin family protein (.1)		Lus10027460 [exp]	81.1	0.7621

Compare expression of checked genes

Lus10011097 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.