Lus10011112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28850 365 / 1e-127 ATXTH26, XTH26, XTR18 xyloglucan endotransglucosylase/hydrolase 26 (.1)
AT4G25810 306 / 2e-104 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 303 / 3e-103 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57530 299 / 1e-101 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT3G23730 297 / 7e-101 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G57560 294 / 8e-100 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57540 294 / 1e-99 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT4G30270 291 / 1e-98 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT2G18800 291 / 3e-98 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT4G14130 289 / 1e-97 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012978 493 / 4e-178 AT4G28850 359 / 3e-125 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10043232 459 / 2e-164 AT4G28850 241 / 3e-78 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10010938 310 / 4e-106 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 310 / 6e-106 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 309 / 2e-105 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 307 / 7e-105 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 299 / 2e-101 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 293 / 3e-99 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 293 / 3e-99 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G160700 492 / 9e-178 AT4G28850 390 / 9e-138 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.018G084300 489 / 1e-176 AT4G28850 403 / 1e-142 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.018G095100 315 / 4e-108 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 312 / 7e-107 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G201200 312 / 7e-107 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.006G170100 311 / 2e-106 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 311 / 2e-106 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G170001 311 / 2e-106 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.002G060500 311 / 2e-106 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.018G094900 310 / 5e-106 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10011112 pacid=23167572 polypeptide=Lus10011112 locus=Lus10011112.g ID=Lus10011112.BGIv1.0 annot-version=v1.0
ATGGCAACTCTTGGTTACTCCTCCTCCACTGTGTTTGTTGTATTGGCATTGACTGCATTTTCAATAATAGCATTCCATCCCACCTCCGTGGATGCTAAGT
TCTCCAAAAGTGTCTACTTCTACTGGGGTGCTCACCACTCTTCTATCCTTGGCAATGGGGATGACCTCCAGCTTGTGTTGGATCAATCCTCTGGGTCCGG
GATCAAGTCCAAGCGGCCGTTCTTGTTTGGCACCATTGAGATGCTAATCAAGTTGGTCCCTGGCAACTCTGCAGGAACAGTCACTGCATATTATATATCG
TCTACTGGAGACAGGCACGATGAGATCGACTTCGAGTTCTTAGGAAATGTGTCGGGGCAACCGTACATCATCCACACAAACATCTACACCCAAGGTAATG
GAAGCAGGGAGCAGCAGTTCTATCCTTGGTTTGACCCAACTGCTGATTTCCACAACTACACCATTCACTGGAATCCTACTTCCATTGTATGGTATGTGGA
TAGCGTGCCAATCAGAGTGTACCGCAACTACGAGAGCAAAGGGGTACCATACCCAAATAAACAAGGGATGAGGGTCTACTCTAGCCTCTGGAACGCAGAT
AACTGGGCTACTAGAGGAGGGTTGGATAAGATCGACTGGAAGTCCGCTCCTTTCATAGCGAGATACCGCAATTTCAGGGCGAGGGCTTGCAAGTATGATG
GACCTGCAAGCATCAACCAATGTGCTGCAACTACTCCAGCAAACTGGTGGACATCTGCTACTCACAAACAGCTGAGCTTTTCCAAACAAGGACAGATGAA
ATGGGTGAGGGACAAGTACATGATCTATGACTACTGCAGAGATTTCAAGAGGTTCAATGGCAATATCCCAGCTGAATGCTTCAACCCACAATTCTAA
AA sequence
>Lus10011112 pacid=23167572 polypeptide=Lus10011112 locus=Lus10011112.g ID=Lus10011112.BGIv1.0 annot-version=v1.0
MATLGYSSSTVFVVLALTAFSIIAFHPTSVDAKFSKSVYFYWGAHHSSILGNGDDLQLVLDQSSGSGIKSKRPFLFGTIEMLIKLVPGNSAGTVTAYYIS
STGDRHDEIDFEFLGNVSGQPYIIHTNIYTQGNGSREQQFYPWFDPTADFHNYTIHWNPTSIVWYVDSVPIRVYRNYESKGVPYPNKQGMRVYSSLWNAD
NWATRGGLDKIDWKSAPFIARYRNFRARACKYDGPASINQCAATTPANWWTSATHKQLSFSKQGQMKWVRDKYMIYDYCRDFKRFNGNIPAECFNPQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28850 ATXTH26, XTH26,... xyloglucan endotransglucosylas... Lus10011112 0 1
AT4G28850 ATXTH26, XTH26,... xyloglucan endotransglucosylas... Lus10043232 1.4 0.9074
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10025762 2.4 0.8527
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10040948 3.2 0.9082
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10039171 4.5 0.8288
Lus10000377 5.3 0.8490
AT4G02270 RHS13 root hair specific 13 (.1) Lus10041926 5.7 0.8839
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10009837 6.9 0.8779
AT3G10710 RHS12 root hair specific 12 (.1) Lus10033399 8.9 0.8635
AT5G22410 RHS18 root hair specific 18 (.1) Lus10004859 11.3 0.8416
AT1G12560 ATHEXPALPHA1.26... expansin A7 (.1) Lus10024478 11.5 0.8258

Lus10011112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.