Lus10011117 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50720 115 / 6e-33 Stigma-specific Stig1 family protein (.1)
AT4G26880 113 / 4e-32 Stigma-specific Stig1 family protein (.1)
AT5G55110 107 / 7e-30 Stigma-specific Stig1 family protein (.1)
AT1G11925 71 / 1e-15 Stigma-specific Stig1 family protein (.1)
AT1G53130 65 / 2e-13 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT1G50650 61 / 1e-11 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011146 261 / 4e-90 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10043047 253 / 7e-87 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10041930 73 / 1e-16 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10005544 70 / 8e-16 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10020831 64 / 5e-13 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10012679 62 / 2e-12 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Lus10006512 56 / 3e-10 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
Lus10000696 56 / 8e-10 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G356600 144 / 2e-44 AT1G50720 133 / 2e-40 Stigma-specific Stig1 family protein (.1)
Potri.011G080800 138 / 8e-42 AT1G50720 130 / 3e-39 Stigma-specific Stig1 family protein (.1)
Potri.004G030900 87 / 9e-22 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Potri.004G006800 81 / 8e-20 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1)
Potri.004G006900 80 / 2e-19 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 77 / 6e-18 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
Potri.010G228100 71 / 1e-15 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 70 / 3e-15 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007200 71 / 4e-15 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007000 67 / 2e-14 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Lus10011117 pacid=23167531 polypeptide=Lus10011117 locus=Lus10011117.g ID=Lus10011117.BGIv1.0 annot-version=v1.0
ATGACCACCACTGCGGTCCTCGTCAAGACGATGCTCCTCATATTCGTAGCCACCGCCATCTCCGTCGCCCTCACCGAGCAAACCATCAACCCTCCTCAAC
AAGAACCCACTAGGCCGGTTAGCCGATTCCTCAAGCAAGAAGGCACTACTAGTACTAGTACCAGGGATGGCATCCCCGGGATTGGTGGAAACAATGGAAA
TGGTGAAGGAGGGGGAGGGATTAAGAACCCCAAGGCGGCCGACCACTGCAACAATGACCCCGGTTTGTGTGAGGCCCTATACGGAAAGGGCTTTGCCTGT
TGCAACAACAAGTGTAAGGATTTGAACTCCGACAAGCAGAACTGCGGTTCGTGCAAGACCAAGTGCGACTTCAAGGACGAGTGTTGCCGCGGGGAGTGTG
TCTTCCTGTCCCTCGACAAGCGCCACTGCGGAAAGTGCAATTCCCCTTGTGCCCCCGGACAACCTTGTGTCTACGGCATGTGCAATGACCACATCGATCC
ATCTTCATATCCGATCCATCTACGACTGCCGTTACATTATTATATTATTATTATATTTTAA
AA sequence
>Lus10011117 pacid=23167531 polypeptide=Lus10011117 locus=Lus10011117.g ID=Lus10011117.BGIv1.0 annot-version=v1.0
MTTTAVLVKTMLLIFVATAISVALTEQTINPPQQEPTRPVSRFLKQEGTTSTSTRDGIPGIGGNNGNGEGGGGIKNPKAADHCNNDPGLCEALYGKGFAC
CNNKCKDLNSDKQNCGSCKTKCDFKDECCRGECVFLSLDKRHCGKCNSPCAPGQPCVYGMCNDHIDPSSYPIHLRLPLHYYIIIIF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G50720 Stigma-specific Stig1 family p... Lus10011117 0 1
AT5G60520 Late embryogenesis abundant (L... Lus10031532 5.3 0.9502
AT1G50720 Stigma-specific Stig1 family p... Lus10043047 8.4 0.9407
AT5G54370 Late embryogenesis abundant (L... Lus10026972 11.7 0.9389
AT1G50720 Stigma-specific Stig1 family p... Lus10011146 12.5 0.9296
AT5G54370 Late embryogenesis abundant (L... Lus10037886 13.9 0.9349
AT5G60520 Late embryogenesis abundant (L... Lus10015149 16.7 0.9220
AT2G43870 Pectin lyase-like superfamily ... Lus10022530 19.4 0.9302
AT5G54370 Late embryogenesis abundant (L... Lus10038588 19.5 0.9195
Lus10004308 20.6 0.8488
AT4G15390 HXXXD-type acyl-transferase fa... Lus10025730 22.0 0.9175

Lus10011117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.