Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G35190 414 / 6e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 373 / 7e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46480 309 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 282 / 5e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16770 254 / 6e-83 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16765 206 / 3e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G50210 117 / 4e-30 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 112 / 2e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 106 / 4e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49620 105 / 1e-25 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043026 [exp] 597 / 0 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10012963 [exp] 523 / 0 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10034964 [exp] 520 / 0 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004746 [exp] 238 / 7e-77 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007820 [exp] 188 / 2e-57 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021002 [exp] 106 / 4e-26 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023602 [exp] 87 / 2e-19 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10008100 [exp] 87 / 3e-19 AT4G21690 273 / 8e-90 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 3, gibberellin 3-oxidase 3 (.1) Lus10004387 [exp] 86 / 9e-19 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G086900 [exp] 506 / 0 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G086800 [exp] 492 / 1e-176 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G079600 [exp] 258 / 6e-85 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G047100 [exp] 114 / 3e-29 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.004G146100 [exp] 96 / 5e-22 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 95 / 5e-22 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 89 / 6e-20 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.006G101100 [exp] 85 / 3e-18 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G107550 [exp] 82 / 1e-17 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.019G014454 [exp] 82 / 1e-17 AT5G08640 454 / 1e-161 flavonol synthase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10011126 pacid=23167525 polypeptide=Lus10011126 locus=Lus10011126.g ID=Lus10011126.BGIv1.0 annot-version=v1.0 ATGGAGAATCAGCAGCAGCAACAGCAAGGAAATATCACCGCCGTAACTTCGCTGAATTGCATTGATCTCTCCACTCCGGTCGACTCTCCTAATTCCGTCT CCTTGCTCAAACAGGCGTGCCTGGATTGTGGGTTTTTCTACTTGGTCAATCATGGGATAAGCCAAGAGTTCATGGCGGAGGTATTTGCTCAGAGCAAGAA GTTCTTCGAATTGCCATTGATTGAGAAGATGGAAGTTCTTAGGAACGAGAAGCATAGAGGGTACACTCCAGAGCTGGACGAGCTTTTGGATCCTGGAAAT CAACTTCATGGAGATTATAAGGAGGGTTACTATATAGGATTAGAAATTCCTGAAGATGATCCAGCAGCCAAAAAGCCATTCCATGGTCCTAACGTTTGGC CATCATCATCAGACCTTTTGCCTGGTTGGAGGGAAACCATGGAAAAGTTTCATCAGCAAGCTCTAGAGGTAGCGCGAAAAGTTGCGAGGATTATAGCACT TGCGCTAGATTTAGAAGCTGATTTCTTCGACAAACCAGAGATTCTTGGTCACCAGCCTATTGCATTAATGCGATTGCTGCGTTATGGAGGTCAGGTTTCT GATCCCATGAAGGGATTATATGGAGCTGGAGCCCATTCCGACTACGGTTTGATTACCCTTCTTGCCACAGATGAAGTCTATGGTCTCCAAATCTGCAGGA ATAAGGATGCTGAACCTCAAGTATGGGAATATGTACCACCAATGCAAGGGTCTACATTACATAGAGTTATAGGGAATGGTCAAGAGAGATATTCCATTGC ATACTTCGTGGAACCAAATTATGACTGTCTAGTCGAATGCTTGTCAACATGTAAATCGGAGAAAAATCCGCCCAAGTTCCCCCCAGTCAGATATGGAGAA TACTTGGGGCAACGCTACAAGGACACCCATGCTGATTTGAGGGTTTACAGCCAGAAGCAGCATATGTAG
AA sequence Show only first row Show all	>Lus10011126 pacid=23167525 polypeptide=Lus10011126 locus=Lus10011126.g ID=Lus10011126.BGIv1.0 annot-version=v1.0 MENQQQQQQGNITAVTSLNCIDLSTPVDSPNSVSLLKQACLDCGFFYLVNHGISQEFMAEVFAQSKKFFELPLIEKMEVLRNEKHRGYTPELDELLDPGN QLHGDYKEGYYIGLEIPEDDPAAKKPFHGPNVWPSSSDLLPGWRETMEKFHQQALEVARKVARIIALALDLEADFFDKPEILGHQPIALMRLLRYGGQVS DPMKGLYGAGAHSDYGLITLLATDEVYGLQICRNKDAEPQVWEYVPPMQGSTLHRVIGNGQERYSIAYFVEPNYDCLVECLSTCKSEKNPPKFPPVRYGE YLGQRYKDTHADLRVYSQKQHM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Lus10011126 [exp]	0	1
AT4G37880			LisH/CRA/RING-U-box domains-co...		Lus10020487 [exp]	2.4	0.9195
AT1G15200			protein-protein interaction re...		Lus10023800 [exp]	3.3	0.9291
AT3G12550		FDM3	factor of DNA methylation 3, X...		Lus10000948 [exp]	3.9	0.9206
AT5G06830			unknown protein		Lus10016277 [exp]	4.0	0.9210
AT5G37590			Tetratricopeptide repeat (TPR)...		Lus10020809 [exp]	4.0	0.9075
AT1G16670			Protein kinase superfamily pro...		Lus10042851 [exp]	6.7	0.9261
AT2G39080		EMB2799	EMBRYO DEFECTIVE 2799, NAD(P)-...		Lus10038637 [exp]	6.9	0.8938
AT1G61780			postsynaptic protein-related (...		Lus10002066 [exp]	6.9	0.9005
AT1G04610		YUC3	YUCCA 3 (.1)		Lus10032609 [exp]	7.1	0.9019
AT2G16720	MYB	AtY49, AtMYB7	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10028435 [exp]	7.5	0.9122

Compare expression of checked genes

Lus10011126 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.