Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043038 [exp] 134 / 1e-42 ND 37 / 5e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G106700 [exp] 60 / 2e-13 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011136 pacid=23167574 polypeptide=Lus10011136 locus=Lus10011136.g ID=Lus10011136.BGIv1.0 annot-version=v1.0 ATGAGGAACACCGGAAAGAGTTACAAAGCTGCTCCGTATGGCAACGGCAGCAGCAGCAACAACAACAACAAGACATTCGATGCTAGGCTGGACAGGAAAT CAGCAACTGGTATGAACGGATCTCCCAAGAAAGGAGGCCACGGAGGCAAGTTCACTTGGATTGGTGGCGACGGTTTCTACTCACACGAGGAGATGGGGCG CCACGGAGGCGGAGTAGCTGCGGATCTCAACTCCGAGAAACCACAGCCCGAGGAGGAGGAGGTCCCGATCCAGACCCCCTGA
AA sequence Show only first row Show all	>Lus10011136 pacid=23167574 polypeptide=Lus10011136 locus=Lus10011136.g ID=Lus10011136.BGIv1.0 annot-version=v1.0 MRNTGKSYKAAPYGNGSSSNNNNKTFDARLDRKSATGMNGSPKKGGHGGKFTWIGGDGFYSHEEMGRHGGGVAADLNSEKPQPEEEEVPIQTP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011136 [exp]	0	1
AT1G64280		SAI1, NIM1, NPR...	SALICYLIC ACID INSENSITIVE 1, ...		Lus10018756 [exp]	1.0	0.9185
AT5G63460			SAP domain-containing protein ...		Lus10022457 [exp]	2.0	0.9096
					Lus10010883 [exp]	4.9	0.9041
AT4G27450			Aluminium induced protein with...		Lus10018484 [exp]	6.5	0.9061
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Lus10009847 [exp]	6.7	0.8744
					Lus10043038 [exp]	11.3	0.8412
AT1G15670			Galactose oxidase/kelch repeat...		Lus10017300 [exp]	12.6	0.8550
AT2G37678		PAT3, FRY1, FHY...	PHYTOCHROME A SIGNAL TRANSDUCT...		Lus10012123 [exp]	14.1	0.8497
AT4G19985			Acyl-CoA N-acyltransferases (N...		Lus10028990 [exp]	14.7	0.8451
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Lus10034985 [exp]	16.1	0.8574

Compare expression of checked genes

Lus10011136 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.