Lus10011138 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19760 225 / 2e-77 PRF1, PFN1 profilin 1 (.1)
AT4G29350 222 / 2e-76 PRF2, PFN2, PRO2 profilin 2 (.1)
AT5G56600 221 / 3e-75 PRF3, PFN3 profilin 3 (.1.2)
AT2G19770 215 / 2e-73 PRF5 profilin 5 (.1)
AT4G29340 212 / 3e-72 PRF4 profilin 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043040 265 / 5e-93 AT5G56600 223 / 1e-76 profilin 3 (.1.2)
Lus10012936 253 / 2e-88 AT4G29350 223 / 2e-76 profilin 2 (.1)
Lus10034988 250 / 2e-87 AT4G29340 219 / 3e-75 profilin 4 (.1)
Lus10037591 234 / 8e-81 AT2G19770 231 / 6e-80 profilin 5 (.1)
Lus10006846 231 / 5e-80 AT2G19770 229 / 5e-79 profilin 5 (.1)
Lus10034989 214 / 5e-73 AT4G29340 234 / 6e-81 profilin 4 (.1)
Lus10011139 213 / 2e-72 AT4G29340 238 / 1e-82 profilin 4 (.1)
Lus10043041 212 / 3e-72 AT4G29340 239 / 9e-83 profilin 4 (.1)
Lus10012935 207 / 2e-70 AT4G29340 235 / 2e-81 profilin 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G190800 241 / 4e-84 AT2G19760 196 / 8e-66 profilin 1 (.1)
Potri.003G047700 238 / 2e-82 AT4G29340 224 / 5e-77 profilin 4 (.1)
Potri.006G235200 229 / 4e-79 AT4G29340 216 / 1e-73 profilin 4 (.1)
Potri.018G057600 228 / 7e-79 AT4G29340 188 / 5e-63 profilin 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF00235 Profilin Profilin
Representative CDS sequence
>Lus10011138 pacid=23167520 polypeptide=Lus10011138 locus=Lus10011138.g ID=Lus10011138.BGIv1.0 annot-version=v1.0
ATGTCGTGGCAGACCTACGTTGACGACCATCTCCTCTGCGACGTCGAGGGTAACCACCTCTCTGCCGCCGCCATCATCGGCCACGACGGCAGCGTTTGGG
CCCAGAGCGCCACCTTCCCTCAGTTGAAACCTGAAGAAGTTACTGGTATTATGAATGACTTCGATGAGCCTGGTTCACTAGCACCCACTGGATTGTACCT
TGGAGGCACAAAGTACATGGTGATTCAAGGCGAGGCAGGAGCTGTTATCCGAGGGAAGAAGGGACCTGGCGGGGTAACCATTAAGAAGACCAGTCTTGCC
TTGGTGATTGGTATCTACGATGAGCCAATGACCCCAGGGCAGTGCAATGTAGTCGTGGAAAGGCTTGGCGATTATCTTGTTGATCAGGGTCTTTAA
AA sequence
>Lus10011138 pacid=23167520 polypeptide=Lus10011138 locus=Lus10011138.g ID=Lus10011138.BGIv1.0 annot-version=v1.0
MSWQTYVDDHLLCDVEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFDEPGSLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTIKKTSLA
LVIGIYDEPMTPGQCNVVVERLGDYLVDQGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G19760 PRF1, PFN1 profilin 1 (.1) Lus10011138 0 1
AT2G42590 GENERALREGULATO... general regulatory factor 9 (.... Lus10017650 1.7 0.8859
AT5G65430 14-3-3KAPPA, GF... 14-3-3 PROTEIN G-BOX FACTOR14 ... Lus10035934 1.7 0.9054
AT1G25400 unknown protein Lus10034335 3.0 0.8510
AT3G59350 Protein kinase superfamily pro... Lus10026706 3.2 0.8973
AT2G25290 Phox1 Phox1, Octicosapeptide/Phox/Be... Lus10001927 4.0 0.8561
AT5G47200 AtRABD2b, AtRab... ARABIDOPSIS RAB GTPASE HOMOLOG... Lus10010999 4.9 0.8856
AT4G28530 NAC ANAC074 NAC domain containing protein ... Lus10022915 7.7 0.8681
AT1G04690 KV-BETA1, KAB1 potassium channel beta subunit... Lus10023674 9.8 0.8328
AT5G26751 ATSK11 ,SK 11 ARABIDOPSIS THALIANA SHAGGY-RE... Lus10031440 9.9 0.8617
AT2G04550 DSPTP1E, IBR5 DUAL SPECIFICITY PROTEIN PHOSP... Lus10002263 10.6 0.7960

Lus10011138 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.