Gene [FLAX] | FIBexDB

Lus10011139 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	Alias	TAIR10 short description
AT4G29340	207 / 3e-70	PRF4	profilin 4 (.1)
AT2G19770	198 / 1e-66	PRF5	profilin 5 (.1)
AT4G29350	177 / 2e-58	PRF2, PFN2, PRO2	profilin 2 (.1)
AT2G19760	169 / 3e-55	PRF1, PFN1	profilin 1 (.1)
AT5G56600	165 / 5e-53	PRF3, PFN3	profilin 3 (.1.2)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10043041 [exp]	237 / 4e-82	AT4G29340	239 / 9e-83	profilin 4 (.1)
Lus10034989 [exp]	229 / 7e-79	AT4G29340	234 / 6e-81	profilin 4 (.1)
Lus10012935 [exp]	224 / 4e-77	AT4G29340	235 / 2e-81	profilin 4 (.1)
Lus10037591 [exp]	195 / 2e-65	AT2G19770	231 / 6e-80	profilin 5 (.1)
Lus10012936 [exp]	194 / 6e-65	AT4G29350	223 / 2e-76	profilin 2 (.1)
Lus10006846 [exp]	193 / 1e-64	AT2G19770	229 / 5e-79	profilin 5 (.1)
Lus10034988 [exp]	192 / 2e-64	AT4G29340	219 / 3e-75	profilin 4 (.1)
Lus10011138 [exp]	186 / 7e-62	AT2G19760	225 / 2e-77	profilin 1 (.1)
Lus10043040 [exp]	184 / 3e-61	AT5G56600	223 / 1e-76	profilin 3 (.1.2)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.001G190800 [exp]	198 / 7e-67	AT2G19760	196 / 8e-66	profilin 1 (.1)
Potri.003G047700 [exp]	196 / 4e-66	AT4G29340	224 / 5e-77	profilin 4 (.1)
Potri.006G235200 [exp]	190 / 2e-63	AT4G29340	216 / 1e-73	profilin 4 (.1)
Potri.018G057600 [exp]	189 / 2e-63	AT4G29340	188 / 5e-63	profilin 4 (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
CL0431 [flax] [poplar]	PF	PF00235 [flax] [poplar]	Profilin	Profilin

Representative CDS sequence

Show only first row Show all

>Lus10011139 pacid=23167522 polypeptide=Lus10011139 locus=Lus10011139.g ID=Lus10011139.BGIv1.0 annot-version=v1.0

ATGTCGTGGCAGACATATGTAGATGAGCATTTGATGTGCGAGATTGAAGGGCAGCAGGGACAATATTTGACATCTGCTGCTATCGTCGGCCATGACGGTA

GTATTTGGGCCCAGAGCTCCGCTTTCCCTCAGTTTAAAGGAACAGAGGTGAGTGACATAATGAAAGATTTCGATGAGCCAGGACACCTTGCCCCCACCGG

ATTGCACATTGCCGGAACTAAGTACATGGTTATTCAGGGCGAGTCTGGTGCTGTCATCCGTGGTAAGAAGGGAGCTGGAGGGATAACCATAAAGAAGACG

GGACAAGCACTAGTGGTGGGAATCTACGAGGAGCCAGTGACTCCAGGGCAATGCAACATGATTGTGGAGAGGTTGGGTGATTACCTTCTGGAACAGGGTC

TCTAG

AA sequence

Show only first row Show all

>Lus10011139 pacid=23167522 polypeptide=Lus10011139 locus=Lus10011139.g ID=Lus10011139.BGIv1.0 annot-version=v1.0

MSWQTYVDEHLMCEIEGQQGQYLTSAAIVGHDGSIWAQSSAFPQFKGTEVSDIMKDFDEPGHLAPTGLHIAGTKYMVIQGESGAVIRGKKGAGGITIKKT

GQALVVGIYEEPVTPGQCNMIVERLGDYLLEQGL

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29340		PRF4	profilin 4 (.1)		Lus10011139 [exp]	0	1

Lus10011139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.