Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45630 138 / 3e-41 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT1G12550 121 / 1e-34 HPR3 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT1G79870 107 / 2e-29 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT5G28310 65 / 9e-14 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G68010 64 / 6e-13 ATHPR1, HPR hydroxypyruvate reductase (.1.2) AT1G72190 61 / 4e-12 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT1G17745 58 / 6e-11 PGDH D-3-phosphoglycerate dehydrogenase (.1.2) AT4G34200 54 / 2e-09 EDA9 embryo sac development arrest 9, D-3-phosphoglycerate dehydrogenase (.1) AT3G19480 49 / 5e-08 D-3-phosphoglycerate dehydrogenase (.1) AT5G14780 49 / 6e-08 FDH formate dehydrogenase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036537 [exp] 177 / 3e-56 AT2G45630 384 / 8e-134 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041393 [exp] 172 / 3e-54 AT2G45630 392 / 7e-137 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041391 [exp] 119 / 5e-36 AT1G12550 131 / 3e-38 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10036538 [exp] 115 / 3e-34 AT2G45630 132 / 2e-38 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10043043 [exp] 108 / 6e-31 AT1G48320 151 / 4e-47 Thioesterase superfamily protein (.1) Lus10006708 [exp] 110 / 2e-30 AT1G12550 358 / 4e-124 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10014133 [exp] 110 / 3e-30 AT1G12550 340 / 1e-116 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10035866 [exp] 107 / 4e-29 AT1G79870 466 / 6e-167 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10037552 [exp] 106 / 7e-29 AT1G79870 410 / 6e-145 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G073500 [exp] 153 / 6e-47 AT2G45630 377 / 4e-131 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151100 [exp] 150 / 1e-45 AT2G45630 400 / 3e-140 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073400 [exp] 146 / 6e-44 AT2G45630 405 / 2e-141 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151200 [exp] 143 / 4e-43 AT2G45630 382 / 3e-133 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.003G119000 [exp] 124 / 9e-36 AT2G45630 327 / 2e-111 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G113250 [exp] 124 / 1e-35 AT1G12550 340 / 9e-117 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Potri.003G052700 [exp] 107 / 2e-29 AT1G79870 443 / 7e-158 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G183700 [exp] 102 / 1e-27 AT1G79870 404 / 3e-142 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073600 [exp] 73 / 3e-18 AT2G45630 73 / 4e-17 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.004G175800 [exp] 68 / 2e-14 AT1G68010 660 / 0.0 hydroxypyruvate reductase (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF02826 [flax] [poplar] 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Representative CDS sequence Show only first row Show all	>Lus10011141 pacid=23167546 polypeptide=Lus10011141 locus=Lus10011141.g ID=Lus10011141.BGIv1.0 annot-version=v1.0 ATGGGGAAAACACGAAACTTGATCGACAAGCAAGTGATAGCCGCGCTAGGTAAAGAAGGGGTGATGGTCAACATTGCGAGGGGGGCGGTTGTGGACGAGC AGGAAATGGTGAGGTGTTTAGTGGAAGGAGAGATTGCAGGTGCTGGACTGGATGTGTTCGAGGACGAGCCTGGTATTCCTCAAGTGCTAATGGAGTTGGA CAACGTTGTGTTGAGTCCTCATTCTGCTATTTTCACCAGGGAATCGGTGATGGGCATTGCTCGGCTTGTGGGAAATTTGGAAGCTTTCTTCTCAAACAAA CACTTGCTGTCCGAGTACGAGCTAGGATGA
AA sequence Show only first row Show all	>Lus10011141 pacid=23167546 polypeptide=Lus10011141 locus=Lus10011141.g ID=Lus10011141.BGIv1.0 annot-version=v1.0 MGKTRNLIDKQVIAALGKEGVMVNIARGAVVDEQEMVRCLVEGEIAGAGLDVFEDEPGIPQVLMELDNVVLSPHSAIFTRESVMGIARLVGNLEAFFSNK HLLSEYELG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10011141 [exp]	0	1
AT3G47340		AT-ASN1, DIN6, ...	DARK INDUCIBLE 6, ARABIDOPSIS ...		Lus10026376 [exp]	1.4	0.8797
AT5G37990			S-adenosyl-L-methionine-depend...		Lus10028500 [exp]	3.5	0.8953
AT5G63180			Pectin lyase-like superfamily ...		Lus10014887 [exp]	3.5	0.8790
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10018378 [exp]	10.0	0.8763
AT2G30600			BTB/POZ domain-containing prot...		Lus10016014 [exp]	22.1	0.7858
AT4G13010			Oxidoreductase, zinc-binding d...		Lus10038205 [exp]	34.2	0.8582
AT5G49950			alpha/beta-Hydrolases superfam...		Lus10035807 [exp]	34.9	0.8300
AT4G14060			Polyketide cyclase/dehydrase a...		Lus10008932 [exp]	39.8	0.8413
AT1G60790		TBL2	TRICHOME BIREFRINGENCE-LIKE 2,...		Lus10030590 [exp]	41.6	0.8502
AT4G09890			Protein of unknown function (D...		Lus10033529 [exp]	49.3	0.8203

Compare expression of checked genes

Lus10011141 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.