Lus10011146 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50720 122 / 9e-36 Stigma-specific Stig1 family protein (.1)
AT4G26880 117 / 7e-34 Stigma-specific Stig1 family protein (.1)
AT5G55110 111 / 2e-31 Stigma-specific Stig1 family protein (.1)
AT1G11925 74 / 2e-17 Stigma-specific Stig1 family protein (.1)
AT1G53130 69 / 7e-15 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT1G50650 61 / 6e-12 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011117 261 / 4e-90 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Lus10043047 251 / 1e-86 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10041930 76 / 5e-18 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10005544 74 / 1e-17 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10012679 67 / 3e-14 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Lus10020831 64 / 2e-13 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10006512 60 / 8e-12 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
Lus10000696 58 / 2e-10 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G356600 147 / 6e-46 AT1G50720 133 / 2e-40 Stigma-specific Stig1 family protein (.1)
Potri.011G080800 140 / 4e-43 AT1G50720 130 / 3e-39 Stigma-specific Stig1 family protein (.1)
Potri.004G030900 91 / 1e-23 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Potri.004G006800 86 / 1e-21 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1)
Potri.004G006900 83 / 1e-20 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 81 / 1e-19 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
Potri.010G228100 74 / 5e-17 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 74 / 5e-17 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007200 72 / 5e-16 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.001G399200 71 / 5e-16 AT1G53130 149 / 2e-46 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Lus10011146 pacid=23167568 polypeptide=Lus10011146 locus=Lus10011146.g ID=Lus10011146.BGIv1.0 annot-version=v1.0
ATGACCATCACCGCAGTCCTCGTCAAGACGATGCTCCTCATATTCGTAGCCACCGCCATCTCCGTCACCCTCACCATGCAAACCATCAACCCTCCTCAAC
AAGAACCCACTAGGCCGGTTAGCCGATTCCTCAAGCAAGAAGGCACTACTAGTACTGGTACCGGCGATGGCATCCCCGGGATTGGTGGAAACAACGGAAA
TGGTGAAGGAGGGGGAGGGATTAAGAACCCCAAGGCGGCCGACCACTGCAACAATGACCCCGGTTTGTGTGAGGCCCTATACGGAAAGGGCTTTGCCTGT
TGCAACAACAAGTGTAAGGATCTGAACTCCGACAAGCAGAACTGCGGTTCGTGCAAGACCAAATGCGACTTCATGGACGAATGTTGCCGCGGGGAGTGTG
TCTTCCTGTCCCTCGACAAGCGCCACTGCGGAAAGTGCAATTCCCCTTGTGCCCCCGGACAACCTTGTGTCTACGGCATGTGCAACTACGCTTGA
AA sequence
>Lus10011146 pacid=23167568 polypeptide=Lus10011146 locus=Lus10011146.g ID=Lus10011146.BGIv1.0 annot-version=v1.0
MTITAVLVKTMLLIFVATAISVTLTMQTINPPQQEPTRPVSRFLKQEGTTSTGTGDGIPGIGGNNGNGEGGGGIKNPKAADHCNNDPGLCEALYGKGFAC
CNNKCKDLNSDKQNCGSCKTKCDFMDECCRGECVFLSLDKRHCGKCNSPCAPGQPCVYGMCNYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G50720 Stigma-specific Stig1 family p... Lus10011146 0 1
AT5G60520 Late embryogenesis abundant (L... Lus10031532 2.2 0.9812
AT5G11590 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-bind... Lus10011123 2.6 0.9674
AT5G44390 FAD-binding Berberine family p... Lus10026775 3.3 0.9613
AT5G60520 Late embryogenesis abundant (L... Lus10015149 3.5 0.9730
AT5G54370 Late embryogenesis abundant (L... Lus10037886 3.5 0.9783
AT5G54370 Late embryogenesis abundant (L... Lus10026972 5.2 0.9757
AT5G54370 Late embryogenesis abundant (L... Lus10038588 5.5 0.9698
AT5G60520 Late embryogenesis abundant (L... Lus10015148 6.3 0.9662
AT1G50720 Stigma-specific Stig1 family p... Lus10043047 6.7 0.9705
AT5G15490 UGD3 UDP-glucose dehydrogenase 3, U... Lus10034703 8.4 0.9521

Lus10011146 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.