Plant FIBer expression Database

Lus10011151 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50900 226 / 8e-77 LTD, GDC1 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043055
[exp]
300 / 3e-106 AT1G50900 226 / 1e-76 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
Lus10002765
[exp]
38 / 0.0008 AT4G18950 132 / 1e-37 Integrin-linked protein kinase family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G420900
[exp]
236 / 4e-81 AT1G50900 234 / 1e-79 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
PFAM info
Representative CDS sequence
>Lus10011151 pacid=23167560 polypeptide=Lus10011151 locus=Lus10011151.g ID=Lus10011151.BGIv1.0 annot-version=v1.0
ATGAGTTCTTTGTTTGTGGGTAAGCGTAACCAGGTCGCCTGGGTCCGACCCAGAAGAATCAGAGCATCATCCAAAGTGACGAGAGTGAATGCGTGGTTTA
AGTTCGGCAAGAATGGAGTTGATGCTGAAGGTGCTGGCATTTATGGCAGCCAATCCCGTGATGACTTTGACAGAGATGATGTCGAACAGTATTTCAACTA
CATGGGAATGCTTGCCGTTGAAGGGACATATGACAAGATGGAAGCACTGCTAACCCAAAACATCCATCCAGTGGACATCTTGCTGATGCTAGCAGCTTCC
GAAGGCGATAAGCCCAAACTCGAAGAGCTACTACGAGCCGGTGCTAACTATGATGTCAAGGATGTCGACGGCAGGACAGCGCTCGATAGAGCTACTGATC
AGGAGGTCAAGAACTTCATTCTCGGTTTCTCTACCCAGAAGGCCTGA
AA sequence
>Lus10011151 pacid=23167560 polypeptide=Lus10011151 locus=Lus10011151.g ID=Lus10011151.BGIv1.0 annot-version=v1.0
MSSLFVGKRNQVAWVRPRRIRASSKVTRVNAWFKFGKNGVDAEGAGIYGSQSRDDFDRDDVEQYFNYMGMLAVEGTYDKMEALLTQNIHPVDILLMLAAS
EGDKPKLEELLRAGANYDVKDVDGRTALDRATDQEVKNFILGFSTQKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G50900 LTD, GDC1 LHCP translocation defect, Gra... Lus10011151
[exp]
0 1
AT4G34620 SSR16 small subunit ribosomal protei... Lus10025592
[exp]
2.4 0.9726
AT4G29590 S-adenosyl-L-methionine-depend... Lus10040550
[exp]
2.8 0.9636
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10005719
[exp]
4.7 0.9694
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10010639
[exp]
7.1 0.9670
AT4G21445 unknown protein Lus10002594
[exp]
8.4 0.9571
AT3G44890 RP19, RPL9 ribosomal protein L9 (.1) Lus10041346
[exp]
10.0 0.9614
AT2G33180 unknown protein Lus10023686
[exp]
10.2 0.9523
AT3G60370 FKBP-like peptidyl-prolyl cis-... Lus10042897
[exp]
13.2 0.9584
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Lus10013041
[exp]
13.3 0.9579
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10030091
[exp]
13.4 0.9578

Lus10011151 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.