Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20600 139 / 3e-41 NDR1 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20590 118 / 2e-32 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20610 90 / 6e-22 non-race specific disease resistance protein, putative (.1) AT1G61760 67 / 2e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G05220 63 / 5e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 55 / 3e-09 NHL2 NDR1/HIN1-like 2 (.1) AT5G06320 51 / 1e-07 NHL3 NDR1/HIN1-like 3 (.1) AT2G35460 49 / 6e-07 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35980 46 / 6e-06 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G52470 44 / 3e-05 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043067 [exp] 302 / 4e-105 AT3G20600 154 / 7e-47 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018377 [exp] 55 / 1e-08 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10021288 [exp] 52 / 6e-08 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020066 [exp] 51 / 1e-07 AT4G05220 261 / 6e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006754 [exp] 50 / 3e-07 AT4G05220 263 / 3e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021287 [exp] 46 / 7e-06 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007635 [exp] 46 / 1e-05 AT4G21410 385 / 6e-122 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10016962 [exp] 45 / 1e-05 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10029406 [exp] 45 / 1e-05 AT3G11660 252 / 7e-86 NDR1/HIN1-like 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G418000 [exp] 166 / 1e-51 AT3G20600 144 / 7e-43 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G133900 [exp] 145 / 2e-43 AT3G20600 152 / 2e-46 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023400 [exp] 61 / 2e-11 AT3G20600 59 / 7e-11 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G027400 [exp] 60 / 8e-11 AT4G05220 264 / 8e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 57 / 6e-10 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 50 / 1e-07 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071600 [exp] 50 / 2e-07 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071500 [exp] 41 / 0.0002 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.009G003800 [exp] 39 / 0.001 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011162 pacid=23167536 polypeptide=Lus10011162 locus=Lus10011162.g ID=Lus10011162.BGIv1.0 annot-version=v1.0 ATGTCCTACGGCGACGACGGCGCTTGTTTCAGCTGCTGCAGGTGGTGCTCCAGCTTCCTACTCACCAGCGGCTTCACCGCCCTCTTCTTGTGGCTCAGCC TCCGCCCCTCTTCCCCCAAATGCTACCTCCGCACCTTCTCAGTCCCGCCGCCCCTTACAAACCGCTCCCAGCTGCCTAACCCTCCTCCTCCGTCCAACGT CTCCTTCGAACTCTACCTGGTGAACCCCAACGTCAACAAGGGAGTCTACTACGATCCGGTCGAGGTCAGCTTCTTCCGCGCCTCCAATCGGAGCAATCCC TTAGGGAATTGCACGATCCCGGGGTTCTACCAAGGCCACCAGAAGAAGGCCCCAAAAGGTGGGGTCATCGTCAACGCCACAGGGGAGATTCTACGCACGA CGGACTTCCGGGTCGAAATCGCTACCAGGGTGAGGTATAAGCTCATTTTCTTCAAGACCAAGAGGCATCGGATTGCTGTTGGCGCCGATTTTCAAGTCAA TGGGGACGGGAAAAAAGTCGCCCCAAAGGATGTGAGGCTCAAGTCCAGCGGCAATAGAGTTGGTGGTGGTGGACACGCGTCGTGTAATGGTTGGCCCTTG GGTGTTTTACTTTCCTTGTTTTTTCTTGTGTCCTCGTTTTGA
AA sequence Show only first row Show all	>Lus10011162 pacid=23167536 polypeptide=Lus10011162 locus=Lus10011162.g ID=Lus10011162.BGIv1.0 annot-version=v1.0 MSYGDDGACFSCCRWCSSFLLTSGFTALFLWLSLRPSSPKCYLRTFSVPPPLTNRSQLPNPPPPSNVSFELYLVNPNVNKGVYYDPVEVSFFRASNRSNP LGNCTIPGFYQGHQKKAPKGGVIVNATGEILRTTDFRVEIATRVRYKLIFFKTKRHRIAVGADFQVNGDGKKVAPKDVRLKSSGNRVGGGGHASCNGWPL GVLLSLFFLVSSF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20600		NDR1	non race-specific disease resi...		Lus10011162 [exp]	0	1
AT2G40140	C3HZnF	ATSZF2, CZF1, Z...	\(SALT-INDUCIBLE ZINC FINGER 2...		Lus10028970 [exp]	1.4	0.9616
AT2G40140	C3HZnF	ATSZF2, CZF1, Z...	\(SALT-INDUCIBLE ZINC FINGER 2...		Lus10007493 [exp]	2.0	0.9573
AT5G24590	NAC	TIP, ANAC091	Arabidopsis NAC domain contain...		Lus10032919 [exp]	5.9	0.9390
AT4G27280			Calcium-binding EF-hand family...		Lus10031588 [exp]	6.0	0.9372
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10035840 [exp]	6.2	0.9492
AT4G17230	GRAS	SCL13	SCARECROW-like 13 (.1)		Lus10017554 [exp]	6.9	0.9417
AT2G26530		AR781	Protein of unknown function (D...		Lus10032881 [exp]	7.0	0.9294
AT3G07200			RING/U-box superfamily protein...		Lus10022569 [exp]	7.3	0.9253
AT5G01900	WRKY	ATWRKY62, WRKY6...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10022736 [exp]	8.5	0.9198
AT3G20600		NDR1	non race-specific disease resi...		Lus10043067 [exp]	11.2	0.9054

Compare expression of checked genes

Lus10011162 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.