Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26800 113 / 7e-34 unknown protein AT3G05810 108 / 7e-32 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015444 [exp] 165 / 2e-54 AT5G26800 147 / 2e-47 unknown protein Lus10031426 [exp] 144 / 5e-46 AT5G26800 143 / 8e-46 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G011800 [exp] 125 / 9e-39 AT5G26800 125 / 2e-38 unknown protein Potri.013G007600 [exp] 115 / 1e-34 AT3G05810 116 / 5e-35 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0003 [flax] [poplar] SAM PF09597 [flax] [poplar] IGR IGR protein motif
Representative CDS sequence Show only first row Show all	>Lus10011180 pacid=23147097 polypeptide=Lus10011180 locus=Lus10011180.g ID=Lus10011180.BGIv1.0 annot-version=v1.0 ATGGCGCTTCTGCGGCTGCTATCATCATCATCGCAGGCGAAGCTTCCAGCAGCAGCTGGGTTTTCCAGATTCTACTCTCAATCATCGCCTTATCTTGTGA AAGTTGGGATCCCGGAGTTCCTGAATGGGATAGGGAAAGGTGTTGAAACCCATGTGGTCAAGCTCGAAAACGAGATCGGAGACTTTCAGAAGCTTCTTGT TACCAGGACTTTGAAGCTCAAGAAACTGGGAATCCCTTGCCAACATAGGAAGCTGATATTGAACTACACACAGAAGTATAGGCTCGGACTGTGGCGGCCG AGAGCAGAGCCTCTGAAAGTCAAGTGA
AA sequence Show only first row Show all	>Lus10011180 pacid=23147097 polypeptide=Lus10011180 locus=Lus10011180.g ID=Lus10011180.BGIv1.0 annot-version=v1.0 MALLRLLSSSSQAKLPAAAGFSRFYSQSSPYLVKVGIPEFLNGIGKGVETHVVKLENEIGDFQKLLVTRTLKLKKLGIPCQHRKLILNYTQKYRLGLWRP RAEPLKVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G26800			unknown protein		Lus10011180 [exp]	0	1
AT3G46560		TIM9, EMB2474	embryo defective 2474, Tim10/D...		Lus10038695 [exp]	2.4	0.9258
AT3G59650			mitochondrial ribosomal protei...		Lus10010559 [exp]	5.0	0.8837
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Lus10027668 [exp]	5.5	0.9248
AT4G24940		ATSAE1A, AT-SAE...	SUMO-activating enzyme 1A (.1)		Lus10028846 [exp]	5.9	0.9166
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10013049 [exp]	6.6	0.8732
AT5G23535			KOW domain-containing protein ...		Lus10022069 [exp]	6.7	0.9201
AT3G17300		EMB2786	unknown protein		Lus10037835 [exp]	6.9	0.9129
AT2G46230			PIN domain-like family protein...		Lus10012649 [exp]	8.1	0.9024
AT4G22000			unknown protein		Lus10008487 [exp]	11.3	0.9044
AT5G26800			unknown protein		Lus10015444 [exp]	11.6	0.9044

Compare expression of checked genes

Lus10011180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.