Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015445 [exp] 86 / 8e-24 ND 49 / 2e-09
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011181 pacid=23147176 polypeptide=Lus10011181 locus=Lus10011181.g ID=Lus10011181.BGIv1.0 annot-version=v1.0 ATGGCGGGAGCGTGGCCGATAGTAGCGTTAAGGTCCCTGAGCTTCGGATTCACCTACTCCTCCCTCCGACAGGGAGTCCGGAACTGGGGGCCGCAGCGGT GGCCGGAGCTGGGGTTCTCGATCGTCGACGACGTCGTCTGGAGCTTGGTCTCAGCGGTGGAGTCCGTCGCCCTTGTATCGATGCTCTGCTTCTTCTTCCT CTTCTGCGGATGCACCTTCTGA
AA sequence Show only first row Show all	>Lus10011181 pacid=23147176 polypeptide=Lus10011181 locus=Lus10011181.g ID=Lus10011181.BGIv1.0 annot-version=v1.0 MAGAWPIVALRSLSFGFTYSSLRQGVRNWGPQRWPELGFSIVDDVVWSLVSAVESVALVSMLCFFFLFCGCTF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G49525			unknown protein		Lus10011181 [exp]	0	1
AT2G16600		ROC3	rotamase CYP 3 (.1.2)		Lus10012167 [exp]	5.2	0.8503
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032482 [exp]	5.3	0.8693
AT4G34340		TAF8	TBP-associated factor 8 (.1)		Lus10026530 [exp]	6.0	0.8476
AT3G18490			Eukaryotic aspartyl protease f...		Lus10042978 [exp]	6.5	0.8625
AT2G48010		RKF3	receptor-like kinase in in flo...		Lus10042679 [exp]	11.0	0.8432
AT4G17600		LIL3:1	Chlorophyll A-B binding family...		Lus10001008 [exp]	11.4	0.8252
AT3G02790	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10020216 [exp]	13.0	0.8293
AT3G55780			Glycosyl hydrolase superfamily...		Lus10028258 [exp]	13.0	0.8075
AT2G47840		AtTic20-II	translocon at the inner envelo...		Lus10020219 [exp]	14.1	0.8092
AT2G47450		CPSRP43, CAO	CHLOROPLAST SIGNAL RECOGNITION...		Lus10023973 [exp]	16.0	0.8444

Compare expression of checked genes

Lus10011181 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.