Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22300 54 / 1e-09 AtNIT4, NIT4 nitrilase 4 (.1) AT3G44300 49 / 1e-07 AtNIT2, NIT2 nitrilase 2 (.1) AT3G44320 46 / 8e-07 AtNIT3, NIT3 nitrilase 3 (.1) AT3G44310 46 / 9e-07 NITI, NIT1, ATNIT1 A. THALIANA NITRILASE 1, nitrilase 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021322 [exp] 50 / 3e-08 AT5G22300 265 / 7e-85 nitrilase 4 (.1) Lus10013313 [exp] 47 / 3e-07 AT5G22300 561 / 0.0 nitrilase 4 (.1) Lus10005201 [exp] 46 / 7e-07 AT5G22300 559 / 0.0 nitrilase 4 (.1) Lus10011234 [exp] 0 / 1 AT5G22300 274 / 3e-89 nitrilase 4 (.1) Lus10018449 [exp] 0 / 1 AT5G22300 281 / 6e-92 nitrilase 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G199600 [exp] 51 / 2e-08 AT5G22300 578 / 0.0 nitrilase 4 (.1) Potri.006G207700 [exp] 50 / 3e-08 AT5G22300 369 / 2e-126 nitrilase 4 (.1) Potri.016G074200 [exp] 45 / 2e-06 AT5G22300 358 / 1e-121 nitrilase 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011198 pacid=23147092 polypeptide=Lus10011198 locus=Lus10011198.g ID=Lus10011198.BGIv1.0 annot-version=v1.0 ATGAAACTCTCCGGCGTCAAGATCTGTGGTTCCAATTGGAGAAATCTTCGTTCCCCGGCCCATACCGCCACCCTGGCTGCAAAGGAGAAGGCGGAGAAGA TGATTACCATCACTGCTGCTAATTCCTCACGATTGATTGTGTTCCTTGAAGCATTCATCGGTGGATATCCACGGTTCTTCAGCAGTTTCTCCGCTGGAGA GGAGTTAAAGATGAACGATGATGACCTTAAGAAGTATTGCGACTCCGCCATTGATTATCCCGGTGAGGAGCTTTCATTTGTTGCCTGCACTGGATTTATA CCTTGTTTCTATTTGTTGGGACTATAG
AA sequence Show only first row Show all	>Lus10011198 pacid=23147092 polypeptide=Lus10011198 locus=Lus10011198.g ID=Lus10011198.BGIv1.0 annot-version=v1.0 MKLSGVKICGSNWRNLRSPAHTATLAAKEKAEKMITITAANSSRLIVFLEAFIGGYPRFFSSFSAGEELKMNDDDLKKYCDSAIDYPGEELSFVACTGFI PCFYLLGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22300		AtNIT4, NIT4	nitrilase 4 (.1)		Lus10011198 [exp]	0	1
AT5G03620			Subtilisin-like serine endopep...		Lus10009868 [exp]	14.5	0.6946
AT5G38880			unknown protein		Lus10035251 [exp]	36.8	0.6094
AT1G06710			Tetratricopeptide repeat (TPR)...		Lus10026747 [exp]	48.4	0.6097
AT5G38880			unknown protein		Lus10035250 [exp]	59.5	0.5730
AT1G22460			O-fucosyltransferase family pr...		Lus10020943 [exp]	112.6	0.5562

Compare expression of checked genes

Lus10011198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.