Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G60900 53 / 2e-09 U2 snRNP auxilliary factor, large subunit, splicing factor (.1) AT1G60830 50 / 3e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G36690 47 / 2e-07 ATU2AF65A U2 snRNP auxilliary factor, large subunit, splicing factor (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037299 [exp] 59 / 2e-11 AT1G60900 629 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1) Lus10035713 [exp] 56 / 2e-10 AT1G60900 640 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1) Lus10024026 [exp] 49 / 3e-08 AT4G36690 678 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1.2.3.4) Lus10041725 [exp] 49 / 3e-08 AT4G36690 672 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G028500 [exp] 45 / 8e-07 AT4G36690 601 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1.2.3.4) Potri.005G125500 [exp] 45 / 1e-06 AT4G36690 626 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1.2.3.4) Potri.004G040900 [exp] 43 / 5e-06 AT1G60900 541 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1) Potri.011G050400 [exp] 37 / 0.0004 AT1G60900 532 / 0.0 U2 snRNP auxilliary factor, large subunit, splicing factor (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011201 pacid=23147108 polypeptide=Lus10011201 locus=Lus10011201.g ID=Lus10011201.BGIv1.0 annot-version=v1.0 ATGGATTTGGTAAAATCTGGCCTCTACAATTGGGTTAAAGCGTTCGATCATCATCATCATGCAGCAACTATCTGCCAAATCGTATGCTTAACGACTCGAT CAATCACCGAGGACGATCTGAGAGACGACGGTGACTACGAAGACATCCTCGAAGACAAGCAATATGAAGGCCGGAAATTCGGGAACCTGATTAACAGTGA CCGCCCTTTGCCGGGAGTTGGCAAGGTGTTCTTCGAGTATGGAGACAACGACGATGATACCCCAGAAAGACGATGA
AA sequence Show only first row Show all	>Lus10011201 pacid=23147108 polypeptide=Lus10011201 locus=Lus10011201.g ID=Lus10011201.BGIv1.0 annot-version=v1.0 MDLVKSGLYNWVKAFDHHHHAATICQIVCLTTRSITEDDLRDDGDYEDILEDKQYEGRKFGNLINSDRPLPGVGKVFFEYGDNDDDTPERR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G60830			RNA-binding (RRM/RBD/RNP motif...		Lus10011201 [exp]	0	1
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Lus10021393 [exp]	2.0	0.7861
					Lus10021381 [exp]	5.2	0.7647
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10032324 [exp]	8.7	0.7714
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10021638 [exp]	10.1	0.6866
AT4G16566		HINT4	histidine triad nucleotide-bin...		Lus10007467 [exp]	11.7	0.7616
AT2G06090			Plant self-incompatibility pro...		Lus10029389 [exp]	12.0	0.7576
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10025149 [exp]	13.2	0.7576
AT2G40170		GEA6, ATEM6	LATE EMBRYOGENESIS ABUNDANT 6,...		Lus10030394 [exp]	13.5	0.6930
AT3G42640		AHA8	H\(+\)-ATPase 8, H\(+\)-ATPase...		Lus10019064 [exp]	17.5	0.7354
					Lus10028673 [exp]	18.3	0.7348

Compare expression of checked genes

Lus10011201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.