Lus10011218 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022939 144 / 2e-42 AT1G52490 56 / 2e-08 unknown protein
Lus10022937 143 / 2e-42 AT1G52490 56 / 2e-08 unknown protein
Lus10011210 79 / 2e-17 AT1G32420 87 / 7e-19 F-box and associated interaction domains-containing protein (.1)
Lus10018460 77 / 2e-17 AT1G32420 66 / 9e-12 F-box and associated interaction domains-containing protein (.1)
Lus10013934 76 / 2e-16 AT1G11270 72 / 7e-14 F-box and associated interaction domains-containing protein (.1.2.3)
Lus10015432 73 / 8e-16 ND 37 / 2e-05
Lus10011186 72 / 3e-15 AT3G06240 45 / 3e-05 F-box family protein (.1)
Lus10007277 72 / 4e-15 AT3G04660 82 / 6e-17 F-box and associated interaction domains-containing protein (.1)
Lus10007285 72 / 4e-15 AT3G04660 82 / 7e-17 F-box and associated interaction domains-containing protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011218 pacid=23147154 polypeptide=Lus10011218 locus=Lus10011218.g ID=Lus10011218.BGIv1.0 annot-version=v1.0
ATGCAAGGCGGCGGCCATTTGAGAGAGAGAGAGACAGGGGAGCCACCGATAGGAGGTGGTGGTCGGAAGATAAAAAGCTTTTGGCGGACGGGGCTGGGGA
AATTTCCGGCGGGGTCAATCAGTTGGAGAATAATTGATGCTGTAGTACCTCCTAGATTTGAATTCATTAAGAGTAAGTATGTCAATGGTTCCATCTATTG
GATGACCCACTACTGGGGTGGATACTGGGGTGGACTAGGACAAACTATTGAAGACGAATGGAGGTATTCCGAATCCTTAGCGGCATTTGACATTGGACCG
GAGAAGTTTAGGACGACGAGGATTCCCGAATTCACACTTTCAGGAAGTTACCGGTCCCCCGACGACTTTATAATAGCATTCGATGGGTGTCCAACTGTGT
TGCGTAGCGCAAGATCGCCAACACAGAAGCTTATGGAAATTCCGCGATCGTGA
AA sequence
>Lus10011218 pacid=23147154 polypeptide=Lus10011218 locus=Lus10011218.g ID=Lus10011218.BGIv1.0 annot-version=v1.0
MQGGGHLRERETGEPPIGGGGRKIKSFWRTGLGKFPAGSISWRIIDAVVPPRFEFIKSKYVNGSIYWMTHYWGGYWGGLGQTIEDEWRYSESLAAFDIGP
EKFRTTRIPEFTLSGSYRSPDDFIIAFDGCPTVLRSARSPTQKLMEIPRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011218 0 1
AT2G39730 RCA rubisco activase (.1.2.3) Lus10035616 1.4 0.9963
AT2G17030 F-box family protein with a do... Lus10022619 2.0 0.9961
AT1G62310 transcription factor jumonji (... Lus10004603 2.4 0.9313
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006693 3.9 0.9854
AT5G18460 Protein of Unknown Function (D... Lus10006861 4.5 0.9854
AT5G12060 Plant self-incompatibility pro... Lus10023085 5.0 0.9854
AT1G23540 IGI1, AtPERK12 proline-rich extensin-like rec... Lus10013014 6.0 0.7898
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001037 6.5 0.9283
AT5G03620 Subtilisin-like serine endopep... Lus10003254 6.9 0.9213
AT5G59550 zinc finger (C3HC4-type RING f... Lus10028009 7.1 0.8055

Lus10011218 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.