Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018463 [exp] 108 / 7e-33 ND 37 / 5e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G037500 [exp] 51 / 5e-10 ND / Potri.007G000801 [exp] 40 / 5e-06 ND / Potri.011G046112 [exp] 42 / 8e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011220 pacid=23147111 polypeptide=Lus10011220 locus=Lus10011220.g ID=Lus10011220.BGIv1.0 annot-version=v1.0 ATGGGTCTCATCCAGAAGCAATGCAGAAGCTTGTTCTGGAGGATGAGAGCTTCAGTCAAGAAAGCCGTCAAGAAATGGAGCTCCAGTCAGCATCCCAGTA AGAGATTCCAGTATGATCCTTCCAGCTACGCCCTCAACTTCGACGACGGCGGCTACTGTCGTGGCGGCGGCGGCGGCGGCTACTCGTGTCCGTTGAAGAT TGGTATCAGTGTTGAAGACTCTGTGATCTGGGTTTATGTTTTCTGGGTTTGA
AA sequence Show only first row Show all	>Lus10011220 pacid=23147111 polypeptide=Lus10011220 locus=Lus10011220.g ID=Lus10011220.BGIv1.0 annot-version=v1.0 MGLIQKQCRSLFWRMRASVKKAVKKWSSSQHPSKRFQYDPSSYALNFDDGGYCRGGGGGGYSCPLKIGISVEDSVIWVYVFWV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011220 [exp]	0	1
AT1G23000			Heavy metal transport/detoxifi...		Lus10032445 [exp]	1.0	0.9684
AT4G35190		LOG5	LONELY GUY 5, Putative lysine ...		Lus10003335 [exp]	1.7	0.9527
AT5G48170		SNE, SLY2	SNEEZY, SLEEPY2, F-box family ...		Lus10001172 [exp]	2.0	0.9479
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Lus10030723 [exp]	2.4	0.9621
AT5G59970			Histone superfamily protein (....		Lus10028464 [exp]	5.0	0.9479
					Lus10018463 [exp]	5.2	0.9423
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10019871 [exp]	7.1	0.9149
AT3G05600			alpha/beta-Hydrolases superfam...		Lus10020663 [exp]	7.7	0.9386
AT3G15790		MBD11, ATMBD11	methyl-CPG-binding domain 11 (...		Lus10030108 [exp]	10.7	0.9156
AT5G48905		LCR12	low-molecular-weight cysteine-...		Lus10017233 [exp]	11.4	0.8934

Compare expression of checked genes

Lus10011220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.