Lus10011236 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21570 217 / 6e-72 Protein of unknown function (DUF300) (.1)
AT1G11200 205 / 2e-67 Protein of unknown function (DUF300) (.1)
AT1G77220 54 / 4e-09 Protein of unknown function (DUF300) (.1)
AT4G38360 49 / 1e-07 LAZ1 LAZARUS 1, Protein of unknown function (DUF300) (.1), Protein of unknown function (DUF300) (.2)
AT5G26740 49 / 2e-07 Protein of unknown function (DUF300) (.1), Protein of unknown function (DUF300) (.2), Protein of unknown function (DUF300) (.3)
AT3G05940 48 / 3e-07 Protein of unknown function (DUF300) (.1)
AT1G23070 45 / 3e-06 Protein of unknown function (DUF300) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018447 264 / 2e-90 AT4G21570 464 / 1e-166 Protein of unknown function (DUF300) (.1)
Lus10028621 51 / 3e-08 AT1G77220 316 / 2e-103 Protein of unknown function (DUF300) (.1)
Lus10018920 51 / 4e-08 AT1G77220 316 / 5e-104 Protein of unknown function (DUF300) (.1)
Lus10001058 50 / 9e-08 AT3G05940 675 / 0.0 Protein of unknown function (DUF300) (.1)
Lus10001426 50 / 9e-08 AT3G05940 674 / 0.0 Protein of unknown function (DUF300) (.1)
Lus10035832 48 / 3e-07 AT1G23070 205 / 6e-63 Protein of unknown function (DUF300) (.1)
Lus10022625 42 / 3e-05 AT4G38360 296 / 7e-102 LAZARUS 1, Protein of unknown function (DUF300) (.1), Protein of unknown function (DUF300) (.2)
Lus10003321 42 / 4e-05 AT4G38360 321 / 2e-106 LAZARUS 1, Protein of unknown function (DUF300) (.1), Protein of unknown function (DUF300) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G035900 214 / 4e-71 AT1G11200 436 / 1e-155 Protein of unknown function (DUF300) (.1)
Potri.011G044200 209 / 3e-69 AT1G11200 395 / 1e-139 Protein of unknown function (DUF300) (.1)
Potri.001G405700 192 / 3e-62 AT4G21570 421 / 2e-149 Protein of unknown function (DUF300) (.1)
Potri.005G188200 58 / 9e-11 AT1G77220 756 / 0.0 Protein of unknown function (DUF300) (.1)
Potri.002G071400 56 / 4e-10 AT1G77220 753 / 0.0 Protein of unknown function (DUF300) (.1)
Potri.004G204600 55 / 1e-09 AT4G38360 713 / 0.0 LAZARUS 1, Protein of unknown function (DUF300) (.1), Protein of unknown function (DUF300) (.2)
Potri.009G165600 52 / 2e-08 AT4G38360 717 / 0.0 LAZARUS 1, Protein of unknown function (DUF300) (.1), Protein of unknown function (DUF300) (.2)
Potri.018G062600 48 / 3e-07 AT1G23070 522 / 0.0 Protein of unknown function (DUF300) (.1)
Potri.005G000600 48 / 4e-07 AT3G05940 622 / 0.0 Protein of unknown function (DUF300) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03619 Solute_trans_a Organic solute transporter Ostalpha
Representative CDS sequence
>Lus10011236 pacid=23147131 polypeptide=Lus10011236 locus=Lus10011236.g ID=Lus10011236.BGIv1.0 annot-version=v1.0
ATGGATTTCTCGAACTTCAGTCGAGGTCAGATCACCATTATGGGAACGGGATTGAGTGTGATGCTGACGATGCATTTCACGGTTCAGCTAGTATCACAGC
ATCTATTCTACTGGAAGAACCCCAAGGAGCAGAAGGGCATCATCATTATCCTCCTCATGGCGCCTATATACGCTATCGTGTCGTTCGTAGGGTTGTTGGA
TATCCGTGGGAGTGAAGCTTTCTTCATGTTCTTGGAATCAATCAAGGAGTGTTACGAAGCTTTGGTGATCGCCAAGTTCTTGGCTTTGATGTACAGTTAC
CTGAACATATCCATGAGCAAAAACATTGTCCCGGATGAGATTAAAGGAAGAGAGATTCACCATTCCTTCCCAATGACACTTTTCCAGGTATGA
AA sequence
>Lus10011236 pacid=23147131 polypeptide=Lus10011236 locus=Lus10011236.g ID=Lus10011236.BGIv1.0 annot-version=v1.0
MDFSNFSRGQITIMGTGLSVMLTMHFTVQLVSQHLFYWKNPKEQKGIIIILLMAPIYAIVSFVGLLDIRGSEAFFMFLESIKECYEALVIAKFLALMYSY
LNISMSKNIVPDEIKGREIHHSFPMTLFQV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21570 Protein of unknown function (D... Lus10011236 0 1
AT2G39960 Microsomal signal peptidase 25... Lus10009885 5.5 0.6828
AT3G51370 Protein phosphatase 2C family ... Lus10028408 17.2 0.6841
AT1G03310 ATISA2, ISA2, D... BRANCHING ENZYME 2, ARABIDOPSI... Lus10027999 24.0 0.6466
AT3G60380 unknown protein Lus10042896 35.3 0.6239
AT1G07380 Neutral/alkaline non-lysosomal... Lus10001198 59.9 0.6238
AT5G32440 Ubiquitin system component Cue... Lus10027699 62.0 0.5919
AT3G06240 F-box family protein (.1) Lus10027824 62.1 0.6216
AT5G47780 GAUT4 galacturonosyltransferase 4 (.... Lus10039119 76.5 0.5987
AT3G05880 RCI2A RARE-COLD-INDUCIBLE 2A, Low te... Lus10019890 96.3 0.5968
AT2G39760 ATBPM3 BTB/POZ/MATH-domains containin... Lus10004701 97.0 0.5626

Lus10011236 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.