Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 128 / 4e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72930 116 / 7e-34 TIR toll/interleukin-1 receptor-like (.1.2) AT1G66090 115 / 4e-31 Disease resistance protein (TIR-NBS class) (.1) AT1G72920 112 / 5e-31 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72900 114 / 6e-31 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72950 113 / 1e-30 Disease resistance protein (TIR-NBS class) (.1) AT1G72910 113 / 2e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72890 113 / 4e-30 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72940 111 / 6e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT4G09430 113 / 9e-30 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038533 [exp] 216 / 1e-65 AT1G27170 386 / 7e-114 transmembrane receptors;ATP binding (.1.2) Lus10001040 [exp] 193 / 6e-63 AT5G36930 167 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10038482 [exp] 208 / 7e-63 AT1G69550 386 / 3e-113 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10008415 [exp] 188 / 5e-62 AT5G36930 137 / 5e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008027 [exp] 190 / 5e-61 AT5G36930 197 / 5e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10010574 [exp] 196 / 1e-58 AT5G36930 397 / 4e-119 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10038532 [exp] 192 / 7e-58 AT5G36930 307 / 3e-90 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10023272 [exp] 193 / 1e-57 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004911 [exp] 193 / 1e-57 AT1G27170 387 / 5e-115 transmembrane receptors;ATP binding (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G017082 [exp] 140 / 4e-39 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002300 [exp] 139 / 1e-38 AT5G36930 635 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 138 / 1e-38 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 135 / 3e-38 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G052000 [exp] 135 / 2e-37 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019053 [exp] 135 / 2e-37 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 134 / 2e-37 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 134 / 3e-37 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 134 / 4e-37 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 134 / 4e-37 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10011240 pacid=23147105 polypeptide=Lus10011240 locus=Lus10011240.g ID=Lus10011240.BGIv1.0 annot-version=v1.0 ATGGATTCCCTCCCTCTCCCAGCCGCAGACTACGAGGTTTTCCTCAACTTTAGGGGACCCGACGTCCGTAACAGTTTCGTAGGCTCACTCTATAAGTTCC TGGATAACAATAAGATCCGCACTTTTTACGACGATGAAGAGCTCGGCAAGGGGGAGGAACTGAAGCCCAGCCTCATCAGGGCTCTCGAGCAATCGAAGAT CTACGTCCCAATCTTTTCTCCAGACTATGCTGCTAGTAAGTGGTGCCTTCTGGAGCTAGCTCATATGGTGAAGTGCTATAAGCAAGGAAAGGGTCACCGT ATCTTACCCATATTCTGGATGGTGGAGCCTAGGAATGTGCGGCATCAAGAGGGTCCTTTCCTGAAGTTTTTTGCACATCTCTTGAAGAAATATGATCCAG AAACGATTAATGAATGGAAGGAAGCCCTCCTGAAGGTCGGGCAAATGAAAGGATAG
AA sequence Show only first row Show all	>Lus10011240 pacid=23147105 polypeptide=Lus10011240 locus=Lus10011240.g ID=Lus10011240.BGIv1.0 annot-version=v1.0 MDSLPLPAADYEVFLNFRGPDVRNSFVGSLYKFLDNNKIRTFYDDEELGKGEELKPSLIRALEQSKIYVPIFSPDYAASKWCLLELAHMVKCYKQGKGHR ILPIFWMVEPRNVRHQEGPFLKFFAHLLKKYDPETINEWKEALLKVGQMKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10011240 [exp]	0	1
AT1G27170			transmembrane receptors;ATP bi...		Lus10011241 [exp]	1.0	0.8991
AT5G44510		TAO1	target of AVRB operation1 (.1)		Lus10011242 [exp]	1.4	0.8523
AT5G10010			unknown protein		Lus10006744 [exp]	13.1	0.7233
					Lus10029627 [exp]	14.1	0.7565
AT3G62930			Thioredoxin superfamily protei...		Lus10005941 [exp]	15.5	0.7549
AT3G62930			Thioredoxin superfamily protei...		Lus10029441 [exp]	21.4	0.7112
					Lus10039994 [exp]	23.7	0.7183
AT4G23730			Galactose mutarotase-like supe...		Lus10028739 [exp]	27.6	0.6558
					Lus10030127 [exp]	30.0	0.6946
					Lus10034884 [exp]	33.2	0.7146

Compare expression of checked genes

Lus10011240 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.