Lus10011249 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011249 pacid=23147155 polypeptide=Lus10011249 locus=Lus10011249.g ID=Lus10011249.BGIv1.0 annot-version=v1.0
ATGGAACATGCAGCTGGATCAGGCCTGGGTCTAATACCGTTGCGTGGTTTGCTTGGCCCGATAACCATTGGCCGATATCTGATTCTTGCCCCATTTGACC
CCGGTCCAAAGCTCATCCTCACAAAACAGTCTAAAAAGTCAAAACATCCTTTGTACCTCCAAATGCCGCCGGGACTAAAGAGTGTTCGACATCACAGCCG
GCGACTCCTCCTATGGCCGTCGGCCCCGGTGTTTATTGCCAACAAGGATGCCGCCTTTGGCCCCAGATCCTCCATAGCGGTTGAGCGTGGATCCTCCATC
GCCACAAGCGATTTCCTCTACCGATTCGCCAAGGTGGATCCGAAGCTTTGGATTGAATCCCTCTGGAGCTCGAATATGCTGACGTGGTCACATCTGCAAC
TCCAGGGATGA
AA sequence
>Lus10011249 pacid=23147155 polypeptide=Lus10011249 locus=Lus10011249.g ID=Lus10011249.BGIv1.0 annot-version=v1.0
MEHAAGSGLGLIPLRGLLGPITIGRYLILAPFDPGPKLILTKQSKKSKHPLYLQMPPGLKSVRHHSRRLLLWPSAPVFIANKDAAFGPRSSIAVERGSSI
ATSDFLYRFAKVDPKLWIESLWSSNMLTWSHLQLQG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011249 0 1
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10038514 1.7 0.8848
AT4G29250 HXXXD-type acyl-transferase fa... Lus10041782 6.0 0.9161
AT1G10880 Core-2/I-branching beta-1,6-N-... Lus10005108 8.9 0.7863
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10020865 13.5 0.8862
Lus10011453 15.2 0.8601
AT3G09660 MCM8 minichromosome maintenance 8 (... Lus10015060 23.5 0.7982
AT3G27470 Protein of unknown function (D... Lus10022287 24.0 0.7953
AT4G03220 Protein with RNI-like/FBD-like... Lus10023567 24.8 0.8585
AT1G04645 Plant self-incompatibility pro... Lus10002219 27.2 0.8585
Lus10005830 29.3 0.8585

Lus10011249 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.