Lus10011263 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10500 50 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25420 50 / 3e-07 AT2301, GA5, ATGA20OX1 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G05600 49 / 7e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G60290 49 / 7e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G55970 46 / 4e-06 ATJRG21 jasmonate-regulated gene 21 (.1)
AT1G77330 46 / 4e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30830 45 / 8e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G30040 45 / 1e-05 ATGA2OX2 GIBBERELLIN 2-OXIDASE 2, gibberellin 2-oxidase (.1.2)
AT2G36690 45 / 1e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G24530 45 / 1e-05 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018950 266 / 6e-90 AT3G60290 147 / 3e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10018949 225 / 7e-74 AT2G44800 148 / 1e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10001460 183 / 2e-57 AT2G36690 149 / 7e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011002 56 / 2e-09 AT2G44800 198 / 9e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10035782 56 / 2e-09 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011979 55 / 4e-09 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Lus10011980 53 / 3e-08 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Lus10008564 52 / 3e-08 AT2G19590 423 / 6e-150 ACC oxidase 1 (.1)
Lus10014398 52 / 7e-08 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G185000 159 / 1e-47 AT2G36690 147 / 5e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G048900 66 / 6e-13 AT2G36690 250 / 5e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G048700 66 / 1e-12 AT2G36690 255 / 3e-82 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G049000 62 / 1e-11 AT2G36690 209 / 5e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G080600 58 / 5e-10 AT5G07480 453 / 9e-161 KAR-UP oxidoreductase 1 (.1)
Potri.011G150200 57 / 1e-09 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451700 54 / 7e-09 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451600 54 / 9e-09 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150300 53 / 2e-08 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451500 52 / 4e-08 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10011263 pacid=23149891 polypeptide=Lus10011263 locus=Lus10011263.g ID=Lus10011263.BGIv1.0 annot-version=v1.0
ATGATTCAAGTTCATTCAAGACAAGTAGAAGTAGTGGTGGATGAAGAGATCCCAACCATAGATTACTTCTCCCTCTTCTCTTCTGACCCTATCAAGCGTT
TTGATGCACTCGCACGTCTCTCGTCTGCCTGTGAAGGCTACAGGTTTTTCAACTTGGTGAATCATGGAATTTCGGATAAAGTGATGGAAAATGCACCAAG
TTGGATTGGAGAGTTTTTCGAGAAGAATGGTGTGGAAGAGAAGAGCAAGTATAGAAAAGGAGATCCAAAAGCTAGGATTCTTCAGGATGGCAGGTGTCAC
GCCGGTGAGAATAAGGAACATCTTAAGCTACTGGCTCGTCCTCAACTCCATTGCCCTCTTAATCCTGCGGAGGCTTTGGGAGATTACGTGACCAAGTTCC
ACCAAGTGAAGCTAGGGCTAGCAAGAGCGATATCCACAATTCTAGGACAAGAAGAGTCCTACATCAACTTTCGATCTCGAGTCAGACTTCGATGTGGCAG
CAATGAACCAATACTAGCCAAATTTCGAGTCAAAAGGAACCATGGGTTTGGCCGAACACACTGA
AA sequence
>Lus10011263 pacid=23149891 polypeptide=Lus10011263 locus=Lus10011263.g ID=Lus10011263.BGIv1.0 annot-version=v1.0
MIQVHSRQVEVVVDEEIPTIDYFSLFSSDPIKRFDALARLSSACEGYRFFNLVNHGISDKVMENAPSWIGEFFEKNGVEEKSKYRKGDPKARILQDGRCH
AGENKEHLKLLARPQLHCPLNPAEALGDYVTKFHQVKLGLARAISTILGQEESYINFRSRVRLRCGSNEPILAKFRVKRNHGFGRTH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25420 AT2301, GA5, AT... GA REQUIRING 5, ARABIDOPSIS TH... Lus10011263 0 1

Lus10011263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.