Lus10011268 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41630 51 / 1e-07 F-box/RNI-like superfamily protein (.1)
AT5G53840 51 / 1e-07 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT1G13570 48 / 1e-06 F-box/RNI-like superfamily protein (.1)
AT3G58860 47 / 2e-06 F-box/RNI-like superfamily protein (.1)
AT5G25860 47 / 3e-06 F-box/RNI-like superfamily protein (.1)
AT1G66290 46 / 5e-06 F-box/RNI-like superfamily protein (.1)
AT1G60410 46 / 5e-06 F-box family protein (.1)
AT1G69630 46 / 5e-06 F-box/RNI-like superfamily protein (.1)
AT5G03100 46 / 6e-06 F-box/RNI-like superfamily protein (.1)
AT1G80960 45 / 1e-05 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028722 197 / 8e-61 AT2G42730 76 / 1e-14 F-box family protein (.1.2)
Lus10018863 174 / 1e-54 AT5G44950 62 / 1e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10028602 124 / 2e-34 AT1G80960 50 / 1e-06 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Lus10028721 112 / 9e-32 AT5G53840 56 / 5e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10028558 108 / 1e-30 AT3G51530 56 / 4e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10005646 106 / 1e-28 AT1G80960 57 / 1e-09 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Lus10005091 102 / 2e-25 AT1G69010 149 / 5e-41 BES1-interacting Myc-like protein 2 (.1)
Lus10003089 90 / 3e-22 AT5G53840 54 / 3e-08 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10037151 53 / 2e-08 AT5G02700 60 / 2e-10 F-box/RNI-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G098700 48 / 1e-06 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Potri.011G136200 45 / 1e-05 AT1G56400 215 / 2e-64 F-box family protein (.1.2)
Potri.017G107600 43 / 7e-05 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1)
Potri.011G024300 42 / 0.0001 AT3G49030 116 / 3e-28 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
Potri.010G134200 42 / 0.0001 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1)
Potri.013G146800 42 / 0.0002 AT1G69630 71 / 5e-13 F-box/RNI-like superfamily protein (.1)
Potri.011G024200 41 / 0.0003 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.015G002100 40 / 0.0005 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1)
Potri.015G011200 39 / 0.001 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
PFAM info
Representative CDS sequence
>Lus10011268 pacid=23149934 polypeptide=Lus10011268 locus=Lus10011268.g ID=Lus10011268.BGIv1.0 annot-version=v1.0
ATGGCGCCTTTCGACTCTGTTTCTACATCAGCAGGAGAAGATGAAGTTGATTTATGTATAACTCATAAGTTATTTGATGAAGTTTGTATGTTAGGGGGAG
GATTGGATTGGATTAGTGAGTTGCCCGATGAACTTGTCATCAATATCGTATCTCGTTTGACGTCTCTGCGAGAAGCCGTTAGAACATCAGTCCTGTCAAG
TAAGTGGATAAACTTGTGGAAATCAGCCGTTTTGGTGCTCGACTTTGATGGCTCGGAGGAGTTGCGGGACATTTGCAAGCTGGACTGGATCCCAGTAAGA
ATTCTTCAGGAGAAGAGGCGTTGGTACAAGAATTGGGTGAACGGTGTTATATCCCAAGTGCAACAACAGAGTTGCTCAAGAATAAGCAAGTTGAGCCTTT
TATTTAACTTGACAAATAATTGCAATTCGGAAGGGGATATTGATAGATGGATCAAGTTTGCAATTTCAAAGAGGGTTGAGTCTCATCATCTGGCTTTCAT
CTGGGAAACGGTTATCTTCGAACTACTTTTTTTCGGAGGAATGTTACAGTCGCATGAAAACTCCAGCCGGAATGCATGA
AA sequence
>Lus10011268 pacid=23149934 polypeptide=Lus10011268 locus=Lus10011268.g ID=Lus10011268.BGIv1.0 annot-version=v1.0
MAPFDSVSTSAGEDEVDLCITHKLFDEVCMLGGGLDWISELPDELVINIVSRLTSLREAVRTSVLSSKWINLWKSAVLVLDFDGSEELRDICKLDWIPVR
ILQEKRRWYKNWVNGVISQVQQQSCSRISKLSLLFNLTNNCNSEGDIDRWIKFAISKRVESHHLAFIWETVIFELLFFGGMLQSHENSSRNA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G41630 F-box/RNI-like superfamily pro... Lus10011268 0 1
AT1G04970 lipid-binding serum glycoprote... Lus10014625 4.6 0.9522
AT3G26100 Regulator of chromosome conden... Lus10006242 4.7 0.9515
AT2G26000 BRIZ2 BRAP2 RING ZnF UBP domain-cont... Lus10035023 5.5 0.9419
AT1G62040 ATG8C autophagy 8c, Ubiquitin-like s... Lus10015563 8.3 0.9493
AT5G13990 ATEXO70C2 exocyst subunit exo70 family p... Lus10012555 10.2 0.9409
AT1G10800 unknown protein Lus10037441 12.7 0.9325
AT5G58220 ALNS, TTL allantoin synthase, transthyre... Lus10035966 15.0 0.9365
AT2G23450 Protein kinase superfamily pro... Lus10032741 15.9 0.9479
Lus10009362 17.0 0.9233
AT1G44770 unknown protein Lus10014131 19.5 0.9456

Lus10011268 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.