Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49310 63 / 6e-15 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040476 [exp] 135 / 3e-43 AT1G49310 65 / 3e-15 unknown protein Lus10028788 [exp] 38 / 0.0003 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G153200 [exp] 51 / 4e-10 AT1G49310 48 / 2e-08 unknown protein Potri.009G114400 [exp] 50 / 1e-09 AT1G49310 45 / 1e-07 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10950 [flax] [poplar] Organ_specific Organ specific protein
Representative CDS sequence Show only first row Show all	>Lus10011281 pacid=23149912 polypeptide=Lus10011281 locus=Lus10011281.g ID=Lus10011281.BGIv1.0 annot-version=v1.0 ATGAGCGAAGCAATTAGGGGAGATCCGCCCGCGGCTGAGGAGTACTGGAAGAAAGTGATGAAGAACGAGCCTCTCCCCAGCTCCATCAAGGAGCTGTTCA ACGACGCCGTCGTTTCATCATCCGACTTTGACGGAAAGAAGCTGAGGTTTGTGGAGGACTTCGACACGACAACCAGCGCCATCATTTACCACGCCGCCAC CGCGGAAGAGCAAACAGCCCTCCCGTAA
AA sequence Show only first row Show all	>Lus10011281 pacid=23149912 polypeptide=Lus10011281 locus=Lus10011281.g ID=Lus10011281.BGIv1.0 annot-version=v1.0 MSEAIRGDPPAAEEYWKKVMKNEPLPSSIKELFNDAVVSSSDFDGKKLRFVEDFDTTTSAIIYHAATAEEQTALP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G49310			unknown protein		Lus10011281 [exp]	0	1
AT4G33950		ATOST1, P44, SR...	SNF1-RELATED PROTEIN KINASE 2....		Lus10040179 [exp]	6.5	0.9267
AT3G21630		LYSMRLK1, CERK1	LYSM DOMAIN RECEPTOR-LIKE KINA...		Lus10030022 [exp]	21.6	0.9152
AT5G14420		RGLG2	RING domain ligase2 (.1.2.3.4)		Lus10000144 [exp]	25.3	0.9135
AT1G80730	C2H2ZnF	ATZFP1, ZFP1	ARABIDOPSIS THALIANA ZINC-FING...		Lus10014350 [exp]	26.8	0.9114
AT2G31570		ATGPX2	glutathione peroxidase 2 (.1)		Lus10027021 [exp]	38.0	0.9036
AT1G49670		NQR	ARP protein (REF) (.1), ARP pr...		Lus10027904 [exp]	41.9	0.9106
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10040765 [exp]	44.5	0.9094
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Lus10027638 [exp]	49.8	0.8987
AT1G45063			copper ion binding;electron ca...		Lus10038098 [exp]	50.0	0.9023
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10009717 [exp]	58.3	0.8798

Compare expression of checked genes

Lus10011281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.