Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011286 pacid=23149915 polypeptide=Lus10011286 locus=Lus10011286.g ID=Lus10011286.BGIv1.0 annot-version=v1.0 ATGGAGATTGTGGATGTGGCTGCTGGTGATGTTGCTGTTGAGGATGTGATTGTGATACCAGAAGATGAAGGATGGAAGTTTGAGACCGATTTCTTCAGCG GTAAAGGAGACGATTTCTTCAGCGGTGTAGGAGACGATCTGGGGGATGCAGCTGATGTGACTCTCACTCTCGAGGAGATATGGGGTGCTGCGGAGGAGCA GGAGAGGTACGTAGGCAGCTCCATTGTTGTCGATGTGGCAATGATGAAGGGTGCAGTCTAA
AA sequence Show only first row Show all	>Lus10011286 pacid=23149915 polypeptide=Lus10011286 locus=Lus10011286.g ID=Lus10011286.BGIv1.0 annot-version=v1.0 MEIVDVAAGDVAVEDVIVIPEDEGWKFETDFFSGKGDDFFSGVGDDLGDAADVTLTLEEIWGAAEEQERYVGSSIVVDVAMMKGAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011286 [exp]	0	1
AT5G40390		RS5, SIP1	seed imbibition 1-like, raffin...		Lus10039946 [exp]	1.7	0.7399
AT5G16460			Putative adipose-regulatory pr...		Lus10026836 [exp]	4.9	0.6969
AT2G36780			UDP-Glycosyltransferase superf...		Lus10023894 [exp]	9.4	0.7819
AT3G54670		ATSMC1, TTN8	TITAN8, STRUCTURAL MAINTENANCE...		Lus10013583 [exp]	14.1	0.7017
AT3G24060			Plant self-incompatibility pro...		Lus10033675 [exp]	15.4	0.5449
AT2G20900		DGK5, ATDGK5	diacylglycerol kinase 5 (.1.2....		Lus10039747 [exp]	15.5	0.7474
AT5G67240		SDN3	small RNA degrading nuclease 3...		Lus10019320 [exp]	33.2	0.6453
AT1G78780			pathogenesis-related family pr...		Lus10027315 [exp]	35.2	0.6194
					Lus10030789 [exp]	35.9	0.6967
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10016175 [exp]	43.1	0.6938

Compare expression of checked genes

Lus10011286 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.