Lus10011291 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47740 270 / 4e-91 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 221 / 7e-73 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 218 / 2e-71 PPPDE putative thiol peptidase family protein (.1)
AT5G47310 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 211 / 8e-69 PPPDE putative thiol peptidase family protein (.1.2)
AT1G80690 211 / 1e-68 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 196 / 2e-58 unknown protein
AT4G25680 80 / 7e-18 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 77 / 7e-17 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 59 / 3e-10 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040485 495 / 0 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Lus10039492 321 / 2e-112 AT1G47740 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 283 / 6e-97 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 275 / 1e-93 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10018326 222 / 3e-73 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 221 / 5e-73 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10005341 221 / 8e-73 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 218 / 7e-72 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10040170 212 / 2e-69 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G113168 310 / 3e-107 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 310 / 3e-107 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 304 / 4e-105 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 289 / 3e-99 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 288 / 1e-98 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G261500 236 / 2e-78 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 227 / 6e-75 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 214 / 3e-70 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 212 / 3e-69 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 208 / 1e-67 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10011291 pacid=23149913 polypeptide=Lus10011291 locus=Lus10011291.g ID=Lus10011291.BGIv1.0 annot-version=v1.0
ATGGTCTCAGGAGGATCACAAAAGAGCAATAGGTGGCACTCCATCGATGCATCTCCTCTCAAGGCAAAGCTAGCTAACAAATTCTGCATCTTCCCAAAGT
CCAAGAACCTAGCAAGCTACACTCGCGGCGACACGCCTGTTTACCTCAACGTGTATGACCTCACTACGGCGAATGGTTATGTCTACTGGGCTGGCCTTGG
AATCTTCCACTCTGCAGTTGAAGTCCATGGTGTGGAGTACGCATTCGGAGCCCATGACTTCTCGACTACCGGTGTCTTCGATGTAGAGCCACGAAACTGT
CCCGGCTACTTGTTCAGGAGATCAATATTCATGGGGACTACTACGTTGGATCCTAAGCAGGTCAGGGAATTCATGGAGCGTCAATCTGCTAACTACAATG
GTGATACGTATCATTTGATCTACAAGAACTGCAACCATTTTAGCCAGGATATCTGTTTCAAGCTCGCCGGGAAGTCTATCCCTAAGTGGGTCAATCGGCT
CGCGAAAATAGGTTCTGTGTGCAACTGTGTTCTACCGGAGACGCTAAGGGATCCGAGCGGAACCCACGAATCGAGTAGCCAAGACGAATGCGAGAGCGAG
AAGAAGAGGCTTAGGAGAGGTGGATTCAGCGCTGGGTTTTCATCGATGTCGATATCTCAAGCGGAAGTTTCCATTTCATCATTGTTCAGACATTCTTACT
ACAGCAACACCCGCCATGGGAGTTGA
AA sequence
>Lus10011291 pacid=23149913 polypeptide=Lus10011291 locus=Lus10011291.g ID=Lus10011291.BGIv1.0 annot-version=v1.0
MVSGGSQKSNRWHSIDASPLKAKLANKFCIFPKSKNLASYTRGDTPVYLNVYDLTTANGYVYWAGLGIFHSAVEVHGVEYAFGAHDFSTTGVFDVEPRNC
PGYLFRRSIFMGTTTLDPKQVREFMERQSANYNGDTYHLIYKNCNHFSQDICFKLAGKSIPKWVNRLAKIGSVCNCVLPETLRDPSGTHESSSQDECESE
KKRLRRGGFSAGFSSMSISQAEVSISSLFRHSYYSNTRHGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47740 PPPDE putative thiol peptidase... Lus10011291 0 1
AT5G15140 Galactose mutarotase-like supe... Lus10005251 1.0 0.9757
AT3G58120 bZIP ATBZIP61 Basic-leucine zipper (bZIP) tr... Lus10002185 3.5 0.9645
AT1G64640 AtENODL8 early nodulin-like protein 8 (... Lus10033227 5.3 0.9683
AT3G58120 bZIP ATBZIP61 Basic-leucine zipper (bZIP) tr... Lus10039902 7.9 0.9535
AT1G64390 ATGH9C2 glycosyl hydrolase 9C2 (.1) Lus10003888 8.1 0.9111
AT4G02330 AtPME41, ATPMEP... pectin methylesterase 41, Plan... Lus10031470 8.5 0.9540
AT4G14550 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic... Lus10018766 9.2 0.9552
AT5G47540 Mo25 family protein (.1) Lus10041405 9.3 0.9165
AT1G64650 Major facilitator superfamily ... Lus10000336 9.6 0.9595
AT3G04730 AUX_IAA IAA16 indoleacetic acid-induced prot... Lus10018765 10.6 0.9539

Lus10011291 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.