Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36750 74 / 3e-18 Quinone reductase family protein (.1) AT5G54500 65 / 7e-15 FQR1 flavodoxin-like quinone reductase 1 (.1.2) AT4G27270 61 / 2e-13 Quinone reductase family protein (.1) AT5G58800 51 / 9e-10 Quinone reductase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040486 [exp] 98 / 2e-27 AT4G36750 291 / 6e-100 Quinone reductase family protein (.1) Lus10014325 [exp] 81 / 8e-21 AT4G36750 370 / 2e-130 Quinone reductase family protein (.1) Lus10026035 [exp] 79 / 9e-20 AT4G36750 371 / 4e-131 Quinone reductase family protein (.1) Lus10041718 [exp] 78 / 2e-19 AT4G36750 357 / 3e-125 Quinone reductase family protein (.1) Lus10018401 [exp] 64 / 1e-14 AT4G27270 342 / 3e-121 Quinone reductase family protein (.1) Lus10006748 [exp] 64 / 2e-14 AT4G27270 323 / 5e-114 Quinone reductase family protein (.1) Lus10007612 [exp] 64 / 2e-14 AT4G27270 329 / 1e-115 Quinone reductase family protein (.1) Lus10020076 [exp] 61 / 2e-13 AT4G27270 314 / 2e-110 Quinone reductase family protein (.1) Lus10005862 [exp] 55 / 3e-11 AT5G58800 290 / 5e-101 Quinone reductase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G151100 [exp] 81 / 7e-21 AT4G36750 311 / 4e-107 Quinone reductase family protein (.1) Potri.005G126200 [exp] 74 / 3e-18 AT4G36750 361 / 4e-127 Quinone reductase family protein (.1) Potri.007G029600 [exp] 74 / 4e-18 AT4G36750 362 / 3e-127 Quinone reductase family protein (.1) Potri.001G410700 [exp] 64 / 1e-14 AT4G27270 345 / 1e-122 Quinone reductase family protein (.1) Potri.011G033100 [exp] 64 / 1e-14 AT4G27270 352 / 1e-125 Quinone reductase family protein (.1) Potri.004G028900 [exp] 62 / 5e-14 AT4G27270 352 / 2e-125 Quinone reductase family protein (.1) Potri.011G129400 [exp] 62 / 6e-14 AT4G27270 342 / 2e-121 Quinone reductase family protein (.1) Potri.009G044400 [exp] 54 / 7e-11 AT5G58800 322 / 3e-113 Quinone reductase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011292 pacid=23149919 polypeptide=Lus10011292 locus=Lus10011292.g ID=Lus10011292.BGIv1.0 annot-version=v1.0 ATGGAGGATGGAATCAGAGGAGGGTCGCCTTATGGTGCGGGTGTTTTCTCAGGTGATGGAACAAGGCAACCCAGTGAGACTGAACTTGAGCTTGCTAAAC ACCAGGGCAGATACATGGCCACTTTGGTCAAGAGATTTGCGGCCTCTTCTTGA
AA sequence Show only first row Show all	>Lus10011292 pacid=23149919 polypeptide=Lus10011292 locus=Lus10011292.g ID=Lus10011292.BGIv1.0 annot-version=v1.0 MEDGIRGGSPYGAGVFSGDGTRQPSETELELAKHQGRYMATLVKRFAASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36750			Quinone reductase family prote...		Lus10011292 [exp]	0	1
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Lus10011476 [exp]	3.5	0.7740
AT5G42660			Protein of unknown function (D...		Lus10032863 [exp]	5.7	0.7481
					Lus10012740 [exp]	8.4	0.7642
AT4G37450		ATAGP18, AGP18	arabinogalactan protein 18 (....		Lus10011520 [exp]	14.6	0.7460
AT1G05070			Protein of unknown function (D...		Lus10035288 [exp]	22.0	0.7133
AT1G12040		LRX1	leucine-rich repeat/extensin 1...		Lus10040566 [exp]	22.2	0.7109
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10021718 [exp]	24.8	0.6769
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10026535 [exp]	25.1	0.7110
AT1G62440		LRX2	leucine-rich repeat/extensin 2...		Lus10028097 [exp]	27.1	0.7297
AT2G28470		BGAL8	beta-galactosidase 8 (.1.2)		Lus10000271 [exp]	31.7	0.6412

Compare expression of checked genes

Lus10011292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.