Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57680 54 / 2e-09 Peptidase S41 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040494 [exp] 68 / 5e-10 AT3G57680 692 / 0.0 Peptidase S41 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G055400 [exp] 48 / 7e-09 AT3G57680 668 / 0.0 Peptidase S41 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011300 pacid=23149921 polypeptide=Lus10011300 locus=Lus10011300.g ID=Lus10011300.BGIv1.0 annot-version=v1.0 ATGGGGTTTGATCAGGGAGACGTTCGTAGATCCAACGTCCAATCATCAAGATTGGGACTTAAAGCTGCAGCAAACCATGGTGGAAATGTTCCCACTAAGT ACAACAAAATCAGTGGGATGCTTTCGACTCTCGGGGATCCCTTCACTCGGATCATTAGTCCAAAGAGCAAAGACTCAACGAGCCGGTCTGACATTGGAGA GGTCAAACTACCTCGCGAGTACATTAGTCTCTCGCCGATATCCAGTGCCATTATTCCACATAGAACACCAGACGGTAGATTAGCCAAGACTGGCTATGTG AGACTGTCAGTCTTCTCTCAGCATTCTACCGGACCACAGAGTTAA
AA sequence Show only first row Show all	>Lus10011300 pacid=23149921 polypeptide=Lus10011300 locus=Lus10011300.g ID=Lus10011300.BGIv1.0 annot-version=v1.0 MGFDQGDVRRSNVQSSRLGLKAAANHGGNVPTKYNKISGMLSTLGDPFTRIISPKSKDSTSRSDIGEVKLPREYISLSPISSAIIPHRTPDGRLAKTGYV RLSVFSQHSTGPQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57680			Peptidase S41 family protein (...		Lus10011300 [exp]	0	1
AT5G45140		NRPC2	nuclear RNA polymerase C2 (.1)		Lus10011322 [exp]	4.9	0.8061
					Lus10008674 [exp]	5.4	0.8246
AT3G51150			ATP binding microtubule motor ...		Lus10025969 [exp]	8.6	0.8142
AT3G14440		SIS7, ATNCED3, ...	SALT TOLERANT 1, SUGAR INSENSI...		Lus10026185 [exp]	10.3	0.6546
AT2G28550	AP2_ERF	TOE1, RAP2.7	TARGET OF EARLY ACTIVATION TAG...		Lus10001979 [exp]	17.6	0.7782
AT5G17200			Pectin lyase-like superfamily ...		Lus10014826 [exp]	17.7	0.7028
AT2G40130			Double Clp-N motif-containing ...		Lus10028282 [exp]	18.8	0.7951
AT2G40130			Double Clp-N motif-containing ...		Lus10040206 [exp]	20.6	0.8011
AT1G17820			Putative integral membrane pro...		Lus10040647 [exp]	21.1	0.7906
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Lus10018354 [exp]	21.2	0.7832

Compare expression of checked genes

Lus10011300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.