Lus10011313 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53500 128 / 2e-32 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G24320 125 / 2e-31 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G42010 117 / 9e-29 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G64610 114 / 1e-27 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G02430 103 / 5e-24 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G54200 101 / 4e-23 Transducin/WD40 repeat-like superfamily protein (.1)
AT2G37670 96 / 2e-21 Transducin/WD40 repeat-like superfamily protein (.1)
AT3G15470 92 / 3e-20 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G48870 79 / 9e-16 Transducin/WD40 repeat-like superfamily protein (.1)
AT3G54940 42 / 0.0005 Papain family cysteine protease (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012846 337 / 2e-116 AT5G53500 74 / 4e-15 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10000387 318 / 9e-108 AT5G02430 53 / 1e-14 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003206 298 / 2e-95 AT1G64610 427 / 1e-141 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017312 287 / 4e-91 AT1G64610 439 / 4e-146 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017902 262 / 9e-88 AT5G53500 58 / 3e-10 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10023577 257 / 6e-86 AT5G24320 50 / 7e-08 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10032436 253 / 1e-77 AT5G24320 516 / 1e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10023033 251 / 8e-77 AT5G24320 508 / 3e-171 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10004667 100 / 5e-26 ND 39 / 1e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G144400 200 / 8e-58 AT5G24320 516 / 4e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.001G086600 199 / 2e-57 AT5G24320 514 / 1e-173 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.002G174100 151 / 3e-40 AT5G53500 523 / 1e-177 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.015G009700 143 / 2e-37 AT5G24320 621 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.012G018200 133 / 6e-34 AT5G24320 606 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.007G110500 125 / 2e-31 AT5G24320 411 / 1e-134 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.005G057600 121 / 7e-30 AT5G24320 384 / 3e-124 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.006G084600 112 / 1e-26 AT2G37670 920 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.011G122500 108 / 1e-25 AT3G15470 835 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.001G403400 94 / 9e-21 AT3G15470 828 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Lus10011313 pacid=23149918 polypeptide=Lus10011313 locus=Lus10011313.g ID=Lus10011313.BGIv1.0 annot-version=v1.0
ATGTCTCATCATCACTTTCCCATTCCTCTCACGCTCCCGCCCAGCCTCCAAAAACAGATCCGTATACCATCATCAATCCACAATGATCCCGCAAATCATC
AGCCGCCGTCGGCCAAGAATTCCGACGACAGTCTCTATCATCCTGCTCCATCTATTCCTCTTCTCGATACAGGGGTTTCGATGATGGAGGGCAGAGCTGG
TGAGGATGGTTTGTTTGCGGCAGAGGAGGAGGCGGAGACGATGGACACTAGCGGTTCGCCGGATGAGTTTGACTGGAGGGACAAAGGAGCTGTAACCGAC
GTCAAGATGCAGTTCGCCTATGGAAAGTGGGTTGTGACAATCGGTTGCCTCATGGTTTTTCATCATAATAACTACGTAATGTGTGTTCAGTACAATCCAG
TGGATGAAGACTACTTCATCACTGGATCTATAGATGGAAAAGTTCGGATCTGGGAAGTGTCTGGATGTCGGTTAAATCGCTTACAGACATCAGAGAAATC
GTTGCTGCAATCGCTTACCGTCCTGCTAATTAGAGATGCTGTAGCATGTTCACAAAGGAAAACAAAACTGCCTGGTAAGAGAATAACCAGCTTTGAGTTT
TCTCAATGCCATCCGAGTAGAGTGATTGTGACGTCTGCTGATTTGCATTTGCAGCACGGATTTTTTTCAAAAAGGCACTTGCTTTCTTTTGCGCTTTTTA
GTTTCGCACCTCCGAACCAGATGCATACCACTTTTACTTCGGACGGGAAGAGTGTTGTCTCGACGAGCGACGATTGGAATGCCTACATGTGGACCTACGA
CAAACAGGAGAAGCCGTCCTCTCGAGCTAAGGTTATCCGCTCCTACGAGAGCTTCATTTCCCCTAATGCATCGGTCGCAATACCTTGCCGTGGGATGGAA
ACTGAGCCAGCTGGCACAATCTCATCCCGACGACCTCAATCCGACCATAACCATCACAAGAGCATCATATCCTCGCCGTGTTGTTTCAACATCATTTGCG
GGTTTTTGCTAGATTCTCTATCCAGGGGAGCTGCAACTTGGCAAGAGGGGAATCTTCCTCATTCGAAACTGGTACTCAAATCAGAGTTGAAGTTCAATCC
TCAAATGTAG
AA sequence
>Lus10011313 pacid=23149918 polypeptide=Lus10011313 locus=Lus10011313.g ID=Lus10011313.BGIv1.0 annot-version=v1.0
MSHHHFPIPLTLPPSLQKQIRIPSSIHNDPANHQPPSAKNSDDSLYHPAPSIPLLDTGVSMMEGRAGEDGLFAAEEEAETMDTSGSPDEFDWRDKGAVTD
VKMQFAYGKWVVTIGCLMVFHHNNYVMCVQYNPVDEDYFITGSIDGKVRIWEVSGCRLNRLQTSEKSLLQSLTVLLIRDAVACSQRKTKLPGKRITSFEF
SQCHPSRVIVTSADLHLQHGFFSKRHLLSFALFSFAPPNQMHTTFTSDGKSVVSTSDDWNAYMWTYDKQEKPSSRAKVIRSYESFISPNASVAIPCRGME
TEPAGTISSRRPQSDHNHHKSIISSPCCFNIICGFLLDSLSRGAATWQEGNLPHSKLVLKSELKFNPQM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53500 Transducin/WD40 repeat-like su... Lus10011313 0 1
Lus10000293 2.4 0.6687
AT1G01920 SET domain-containing protein ... Lus10016435 3.0 0.6712
AT2G21250 NAD(P)-linked oxidoreductase s... Lus10042054 8.8 0.6220
AT4G05020 NDB2 NAD(P)H dehydrogenase B2 (.1),... Lus10002601 12.0 0.6436
AT1G65000 unknown protein Lus10026159 12.2 0.6223
AT1G10030 ERG28 homolog of yeast ergosterol28 ... Lus10007238 19.0 0.5908
AT1G04590 EMB2748 unknown protein Lus10015943 24.7 0.6677
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10040148 28.2 0.6137
AT2G22600 RNA-binding KH domain-containi... Lus10002662 37.9 0.6314
AT5G49950 alpha/beta-Hydrolases superfam... Lus10036590 38.1 0.5984

Lus10011313 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.